CAZyme Information: MGYG000000360_02466

Basic Information

• Species: UBA1829 sp900548385
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900548385
• CAZyme ID: MGYG000000360_02466
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562	MGYG000000360_5|CGC7	64384.8	9.695

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000360	4492877	MAG	Sweden	Europe

• Gene Location: Start: 309201; End: 310889 Strand: +

Full Sequence      

MTTHPFCKIHRHMLVLLSLFFLCTYLLPLGIRPLIRPDEFRYAEIPREMLSSGDWIVPRL
NGVRYFEKPATGYQMTAVCFALFGENAFALRLPSVLGVLLTAAFLYFLMYRYSRDPFLPG
LAAGIYLCSGLVFGVGTFAVLDSQLTCMLSLSIMAFYFAWSSSERRYVFCWLIAAGAFAG
VAFLIKGFLAIAVPVIVAVPFLIWQKEWRKLFLFPWIPLLVMLAVVLPWSLAVHQAEPDF
WRYFFFEEHVNRFFSHTYDRKPQPFWYFLPVLLGGMMPAGLLWFVAWRGIARRWLHSSFL
RFLLCWTVLPFLFFSVSSCKLGTYILPCFLPLAALTAIAFRHALRIRPRSAEKTMNVLRR
FWGALWVTVGGSCLIGMSILLFVPRIPSPFPEFNPFPWLFSVCSLGYGILLLQSGTRIFS
TLRFSFLGLCPIILLGIFSIPAVLFGDKMTEIGLTECLNKIPVAPEDIVVTGRGEAAAVA
WKLKRSDLIILGKWGEFEYGFKNYPEYAGRYYPDRALTELAAEKYPRRLVYITMRDLKRK
PLPPELFHYEHAISGGIVLIRF

Enzyme Prediction     

No EC number prediction in MGYG000000360_02466.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	9	524	4.3e-111	0.9407407407407408

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	8.87e-127	14	562	8	550	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	8.00e-50	11	513	7	509	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	2.50e-13	14	244	5	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	4.78e-07	68	229	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46372.1	1.78e-113	16	540	6	531
QSH42095.1	1.56e-97	17	562	8	549
QSH42096.1	5.16e-96	11	503	4	496
AVM46371.1	1.58e-94	21	562	13	557
BCL61706.1	1.39e-92	16	562	9	554

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.78e-36	22	389	42	391	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9R091	5.88e-83	16	546	11	533	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=arnT PE=3 SV=1
A7FHH6	5.88e-83	16	546	11	533	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=arnT PE=3 SV=1
B2K5L1	5.88e-83	16	546	11	533	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=arnT PE=3 SV=1
Q66A06	5.88e-83	16	546	11	533	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=arnT PE=2 SV=1
Q1CIH9	5.88e-83	16	546	11	533	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
88	110
117	139
143	160
167	184
188	204
211	233
265	287
294	316
321	340
361	383
393	412
424	446