CAZyme Information: MGYG000000343_02485

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_02485
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543	MGYG000000343_25|CGC1	62629.64	8.6674

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 1446; End: 3077 Strand: -

Full Sequence      

MNQKKGHILFLIVICYFSFFINNQLIFADIMESRNLVTAREITEEGNWLVPTMNGELRLE
KPPLPTWVAACIELISPDNLPLQRAAAGVMATLLVFFLYAFASRQTSNPLFGLISAVSLC
TSFNIILMGRTATWDIYCHSFMLGAIYFLFSAGGKTGKCWKEFIWAGVFMGLSFLGKGPV
SFYALLLPFLMAWGIVYRPSFRGKVFPLLSMIGICLLISLWWPFLLFLTHKDMLLSVWNK
ESSAWLEHSVRPWYYYWKFFTESGVWSLFLVTALIWPYWKKRIRFRKEYLFAVCWVFMVL
ICLSLLPEKKTRYLLPILIPSALVIAHFFMYCRQCVENRRFLGMDKLFWRMNTLLIAGIV
GLLPVGIYFFFYVAEGMSLGFFIFLIFMLEGIAVYLFYTALKNKILGYLGGILGLFLSVE
IFILPAIVGLFTNPAVNSISAVRDLPEINQLAFYYPCDEGLRIELVYEARRKILPYCFQE
NADLPQLPFILISQKTAEEVLPPNLLEHVELQFIDEFDDNKRPVDSGFHSTMFVRKATLV
KAK

Enzyme Prediction     

No EC number prediction in MGYG000000343_02485.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	415	1.6e-57	0.762962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	8.35e-25	8	394	11	399	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	9.54e-13	39	340	40	341	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	7.20e-08	61	222	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG4346	COG4346	0.005	60	177	135	242	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU59815.1	1.43e-19	38	342	40	352
BBB93296.1	9.65e-17	8	345	9	345
AWY40212.1	1.00e-16	27	326	34	332
QZP32622.1	4.21e-16	27	326	34	332
SDP25972.1	5.61e-16	27	326	34	332

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.10e-12	1	328	1	320	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q4KC80	2.70e-11	32	363	32	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1
A8GDR9	4.77e-11	32	363	34	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1
Q02R27	6.25e-11	32	327	32	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
Q7N3Q9	3.37e-10	32	338	36	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.306233	0.689050	0.002136	0.000974	0.000620	0.000972

TMHMM  Annotations     

start	end
7	28
86	103
110	132
180	197
206	228
254	276
289	307
312	331
352	374
379	398
405	427