CAZyme Information: MGYG000000343_01829

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_01829
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1138		128040.6	7.0322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 1201; End: 4617 Strand: -

Full Sequence      

MSVFFRILLLAGLWGGLAGGAALAQKTPLKLVAVNDCGVTGAQPFLVKGDNYTMPEEIKG
SDEARTCNFGSTVIYAFNGLDIHADYQLEVVYLADHERCQRIVVDGNEIQAPVILETGKE
QSYRIDLPRKAYAYGQLVLVFENAGKGANTIVSGLKLYSSNPAAPEPFRGEEKRALANTL
TYRVDTDVDAEKVLPVYSVVPTSVTGTFQPVLPLNENWLFCPRPGKEFYRQPVDTGWHSI
VVPGQWSMQGFRVDSACFAGYRRMFSVPDDWMGRQVKLRFDGVTSECRVYLNGREIGYHL
GGMTPFEIDITRGLKPGTNELALAVRSESLADMLGSLTQYAAHQLGGITRKVTLFAVPRV
YLSDVRIETELDDRYEKAELKVRMAVTNATAGAVTDVIVRFNVGGSAVTAEKKLPSLAAG
ETWKGVLTAKVEHPRLWSNERPVLYPLTLELCRNGGTTELAEKRFGFREIEVRGNELLVN
GRAVKLRGVCRHEAHPLTGRVLTAELQRQDVELYRAANCNFIRTSHYPPAEELLELCDEA
GMFVEVEAPVCWVGHHANENWKKLNYQDTAYYPYVLQVNMEMIHFYRNHPSVLFWSMANE
SYWNREFAQVQEYVLKADPTRPHSFHDQAYGGFNNQGSSAPIANIHYPGPDGYKMAARSD
RPMVYGEYCHLNVYNRSELVTDPGIRSDWALALAPAWENMYRTKGVLGGSIWSGIDDIFQ
LPDGRAVGYGAWGPVDGWRRPKPEYWDMKKIYSPIRVNTKQLPGGQELLVEVENRYTFLN
LDEVKINWRYGKEEGRVSADVAPGRKGILRIPLALPDSAGTLYLSFTDPRGFVADEFLIP
VGKQEVQKWVDLPSVSARLTTAKDRFVIKGKDFYCAVSRVTGQMLTLKKNGKEVLCGGPW
LMALPLTGGGCYPNHNANTPVYNEWCDGWKVSEIEACQENQQVVITVKGSYHDFSGSYVL
AVNANGELSVDYRFESLVKLNPRQWGLVFAAPADFNRTFWQRRGMWSIYPADHISRPVGE
AELFYAGLPEKVNPRVKPSWDWSRDFNELGSNDFRATRRNIRLAGLKDTTGIRITVRSDG
RQHWRSWLDEDRICFLVADFVTAGNEMFLESYYAPYRKPLKKGDVIEGTVRLRIESGE

Enzyme Prediction     

No EC number prediction in MGYG000000343_01829.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	209	1010	1.5e-129	0.9521276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	3.97e-89	227	901	62	761	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	3.07e-73	200	873	1	670	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	2.91e-60	214	1010	55	911	beta-galactosidase.
PRK10150	PRK10150	5.01e-53	211	622	12	444	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	2.63e-40	470	755	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50207.1	0.0	24	1135	26	1137
QRO24898.1	0.0	6	1134	5	1123
AQT68269.1	9.90e-294	5	1134	5	1213
BBE16084.1	2.05e-281	201	1134	43	985
AOM75904.1	7.67e-240	61	1138	62	1125

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	8.71e-61	214	895	41	742	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	8.76e-61	214	895	42	743	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3BGA_A	3.08e-56	217	1064	58	937	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3DEC_A	2.79e-54	206	1040	36	911	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3IAQ_A	3.50e-50	216	825	71	697	ChainA, Beta-galactosidase [Escherichia coli K-12],3IAQ_B Chain B, Beta-galactosidase [Escherichia coli K-12],3IAQ_C Chain C, Beta-galactosidase [Escherichia coli K-12],3IAQ_D Chain D, Beta-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	4.80e-60	214	895	42	743	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P06864	1.01e-53	212	899	42	759	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q1G9Z4	1.43e-50	228	1066	74	942	Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14) OX=390333 GN=lacZ PE=3 SV=3
Q9K9C6	3.41e-50	214	777	48	635	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
P0C1Y0	5.82e-50	228	1066	74	941	Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus OX=1585 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005275	0.993634	0.000268	0.000366	0.000210	0.000196

TMHMM  Annotations     

start	end
2	24