CAZyme Information: MGYG000000339_00884

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA9475
• CAZyme ID: MGYG000000339_00884
• CAZy Family: CBM51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1742		189506.63	4.0713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000339	1808008	MAG	Sweden	Europe

• Gene Location: Start: 29; End: 5257 Strand: -

Full Sequence      

MKLRRTVSCVLSACMLTSMLPTSVLAVQADRSAGGTTVDYELAEGWEIMGEDTSHYQAQG
VGRVDITAQYGDLYYEGGAARNTAKNVFLHTVEAEDFEISATLDFQPDQDYQTAGLIIYG
GDNANFALTRRYHSWFGGKALCIQGVNDNAFVEGPENKVDPSQTQETIDLRIVKDGTTVT
SYYRLDGQETWTEHDSRTWTSFEGLGADDLKVGLYTGNSMKNGSTATFSNFTIQYEQDAE
PQQLDFFVETEVEQPDQNTVYASDWDWASASVGYGSAQKDCGVDGSNDPIVLGGTTYAKG
IAAHDASKVVYDIEGKGVQRFQAVAGVNRSQGSCEFIVEADGMQLAKTGVLSGSNTQELD
VEIPAGAKTLTLITTTGGDNGNYDHSIWGDAKFVLDPNVNPTDLRKISVFAPGYLPENGT
GVVEVQGEQVNGEQADLSGAAITYESSDEAILTVDGHGNLTAVGAGTATVTVTVTLGETV
KTAQTQLLVGAEQGAYWDITSPDGSISTRFLLTDGQIQYVVQEDGQLAVDASQLGLVTDA
GDFSNSLTFLSQTEPTEVVDEYDLYGAKVSHVKATGKEMTLSFAHEDGAQLDVIVRVYDD
GMAFRYVVRGEDGQPLAISAESTTMTLPAGSTAYAMDYINHNEEIEREHAARELDGRYCM
PLLYKTTDGTWCLISEAALSPDYCGTYLQGDGTGSLNFHHSVEQNGDAETQMPFTSPWRF
VVIGTPEEINLNTMAETLSPDAEGDFSWVESGVTAWTWLNRESTSSGEVYMKYVDFAAEM
GWEYLLLDEGWQPRGSSNGHPEYNYYGYYEWTEELIAYAKEKGARLLVWANHNDLKDPVE
REKRFAQWEEWGIAGVKPDFFNSSSQDYMELYDALIQETAEHHLLLNLHGMPKPAGGRRP
YPHLLTREGVFGHEQELFRPSDVSAFHNCMLPFVRNAVGPADYTPMFSYQNSGSKTPFSL
AHMAAMAVVYESGIQCLADRPDKYIGSPAEFYFKDMPATWDESVVLQADPGELVTIARRN
GEDWYVGAMCNTQQDAVIDLSFLGDGEYYAFICKDGDSLREITSEMKVVTREDTLTIPML
ATGGAAVKIRRNKPSQPESIQLDQTQLTMEKDSKAQLTTTITPENTEMSQVTWTSSDESV
VTVQNGQLVALAPGQAVITAATGFGGELKAQCTVTVTMPQYVLTPDWEVVHPDPDHWQIN
EDGSVTIDTQIGELYSGGKFTVKNLFLTPAKGENFTVDVKLDFQPSGNYQTAGVILFLDE
YNNFCVSRRSHSGFGGEILAYHGINDESFVEKAIADPTVDQAPVYLRIAKEGTVLKAYYS
LDGNDWVQIAQEQNFANFGDGSSLKMGLYVANGDTSGIPDQRIPATFQDFTVTYEGQDAQ
VIPFAQETVYVEGVTLDQDSAQVQVGQTVTLNASVLPQNATCQDVTWSTSDPAVATVDEN
GVVTGVAQGTATITVTTADGGKTARCVVQVGDPQTVNKTLLQKTYDYALTLSTDGVTDTA
KAAFETALANAKVVLDDETATQDQVNAAWDALLEGIWGLGLTQGDKTMLNLLIDRAQEMI
PNEDKYVADHWQQLVDALGQAQKVAADGDAMQEDVDQAAQALLDAILAQRYKADKSILEE
LIRQAENMELTGYTAESVAAFRTALANAQAVLADETLTEDDQKTVDAAVEQLTRAMDGLT
AGGAPEPSDKPETTDKPEETQKPNQVPQTGDSSAVALWTVLLAGCAAGMGALTVVRTRRK
EH

Enzyme Prediction     

No EC number prediction in MGYG000000339_00884.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	495	1089	2.2e-162	0.9793977812995246
CBM51	260	393	4.7e-33	0.9925373134328358

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	3.99e-72	745	997	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	2.00e-46	501	737	1	226	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam08305	NPCBM	7.46e-35	259	393	2	135	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)
pfam14509	GH97_C	1.39e-28	1000	1090	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
smart00776	NPCBM	1.47e-24	259	393	4	144	This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO18240.1	6.31e-136	499	1088	32	613
AEE97714.1	3.79e-114	497	1094	12	595
ATB36826.1	1.18e-112	488	1100	16	601
ADO69318.1	3.71e-108	487	1100	16	603
AZM44837.1	1.51e-98	497	1089	45	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	5.38e-63	501	1090	6	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	5.71e-62	501	1090	20	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5XFM_A	1.75e-59	499	1029	19	583	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3WFA_A	4.06e-29	499	1093	5	707	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	4.08e-29	499	1093	14	716	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7CFN7	3.11e-87	493	1086	31	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
Q8A6L0	2.43e-62	499	1090	25	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	2.34e-28	499	1093	25	727	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
A9WNA0	4.93e-11	255	405	1158	1315	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
P35838	3.38e-09	1393	1481	238	327	Uncharacterized protein CA_C0552 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_C0552 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003775	0.992471	0.001156	0.001078	0.000734	0.000759

TMHMM  Annotations     

start	end
7	29
1713	1735