CAZyme Information: MGYG000000338_01179

Basic Information

• Species: Anaerobiospirillum sp900543125
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Anaerobiospirillum; Anaerobiospirillum sp900543125
• CAZyme ID: MGYG000000338_01179
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741	MGYG000000338_62|CGC1	81627.43	4.5871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000338	3410865	MAG	Sweden	Europe

• Gene Location: Start: 11403; End: 13628 Strand: -

Full Sequence      

MKALKLGALALAITSVFTTTTTQASVFGDGWNSPFRIFSKYRNEDGSWGGYRIPGITTTS
QGTIIAVADKRFAGTAGNTDIVGGGKVNKVWFSYKVSHDGGRSWSDEGFLKPPTFSDSNT
NTNAYKNYISDPQIVHNPDTGSTFVFGYQSNSALTVTTGDFDVFVHKSTDGGMTWDKGQS
IKNSITLGNGFGKTLQGPGKGMYYQGKIYVPIQQFGPDTNNPKNYFASSGFIYSEDDGKT
WKQSSWIISDSNSITNGLDPNGNSVSSESSIFHHKGYIYLAGKRDPAKTGVTNRMVWRTN
DNGKTWESVVEDFIPNNVVGCQSSTLALNDDVYFVAYTTGSGNSRQETYITTNTGKRFKL
YDSDNWNNLNSFGYTSITSDQDNIYVLNEGADDNGAVTDAAGAIFLNNFDYAGKDYANLN
ARLLNSAKDLRYIQDTIMNVKDTHVRGSFGSNDQLGAEAVFVTDKAKLGVFHKSASDVGD
DVYRTIGYDYDSTSLVAETSNLLLNKEGFLTDSIFIGYQYNDVDYLNGANDEVNSFIAGY
ALNLQTDYVDYQFKVNGTFSKHDFTRNNSEGLGKTASFESKVIALTNELSKSFDIFDKKL
TVRPFAGLDSTYFEHEGFTEENGNNFNDITVYQSDNWSHGLFIGAQANGTYELNHGMSLE
YNAKVRYIHELSDVDDWTDSYRVFDTDFMFAAPVNKDDQENILDASASVILNVTERIGVG
IGATIDTSNENMVYGQAKISF

Enzyme Prediction     

No EC number prediction in MGYG000000338_01179.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	37	393	3.4e-40	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.14e-31	41	395	4	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam03797	Autotransporter	4.07e-11	514	724	44	254	Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.
smart00869	Autotransporter	9.06e-10	487	729	20	263	Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type IV pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different peptidase is used and in some cases no cleavage occurs.
pfam13088	BNR_2	9.03e-09	62	385	1	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	1.36e-05	234	360	6	111	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMZ14174.1	1.72e-172	29	741	8	679
QNM15078.1	9.74e-154	11	741	4	715
ASG76455.1	1.32e-147	129	741	37	625
QPR26713.1	3.72e-136	11	741	14	703
AOV98594.1	1.80e-132	37	741	2	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MYV_A	8.73e-13	40	332	171	445	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	9.27e-13	40	332	192	466	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
4Q6K_A	4.64e-12	40	332	174	448	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]
4BBW_A	2.35e-10	40	242	193	388	Thecrystal structure of Sialidase VPI 5482 (BTSA) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]
7AF2_AAA	7.63e-09	51	347	33	303	ChainAAA, Sialidase [Salmonella enterica subsp. enterica serovar Typhimurium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15698	6.68e-10	41	324	42	303	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
P31206	2.71e-08	40	306	193	434	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P29768	5.61e-08	51	347	36	306	Sialidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=nanH PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000250	0.998995	0.000192	0.000190	0.000178	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000338_01179.