CAZyme Information: MGYG000000338_00793

Basic Information

• Species: Anaerobiospirillum sp900543125
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Anaerobiospirillum; Anaerobiospirillum sp900543125
• CAZyme ID: MGYG000000338_00793
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
666		71303.85	7.9209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000338	3410865	MAG	Sweden	Europe

• Gene Location: Start: 17283; End: 19283 Strand: +

Full Sequence      

MSEVNCNPHLYAIIAGEVSGDTLGAGLMKAILRHDPEAKFIGIGGQKMIQCGMVSAFNME
ELSVMGIFEVAAHAIPILKIRSAITKLLLKERPCIMIGIDSPDFNLSVEHALKKAGIKTV
HYVSPSVWAWREKRIVKIKASCDEILALLPFEKEFYDRHDMPCTYVGHTLANSIPVKIDQ
ALARERSGLYKNCVDGVPGKVLAILPGSRRGIIKRMLPIYALSAALLHEKIKDLSFISVA
PNRDIALLIKDIWLEYCPQLSLTVFVGDSQDVIASADACLLTCGTIAFEAMLLKCPMVVA
YKVSRLSAAIARRLLKVNMYSLPNLLAKREIVKELIQEDCTPIKLAHECIRLLTSDNLLM
KKEFTTIHESIKTNTDELAARAVMRLVAQEQQQLSLGLKDELGKLTAEEQALDKLSLVNY
AKKPKELALQNEDQAKSNQAAAAQDQAATADPAASAGADSAEAAAASAADAVTAVSSADT
ADALVGSNTDLNDGADTNSNQSASGKSKRAKRKSKSKSKSKADSTAKETEATANSTTLAA
SDLSSNDVNPSSLSISLEVAQNAAGYRNFLDKTKSASAAASASAGPNASATSSANDSSSA
SQELGLPSVNDAEVPLKNGLDDKTVKKLEKEAKEEAGLSLSEVLSMPNKSARSKNRDIVK
RVTQRI

Enzyme Prediction     

No EC number prediction in MGYG000000338_00793.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	12	371	1.5e-119	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.33e-164	12	390	5	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.59e-136	12	387	5	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.96e-114	12	383	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.19e-112	12	386	9	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	2.64e-44	7	346	226	563	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIV06438.1	1.17e-109	8	387	4	377
AWA99693.1	1.17e-109	8	387	4	377
ANQ17765.1	4.63e-109	8	387	4	377
QFQ76532.1	4.63e-109	8	387	4	377
QSX38312.1	5.63e-109	8	387	6	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.56e-93	8	386	6	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.56e-93	8	386	6	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7MY02	2.88e-108	8	387	4	377	Lipid-A-disaccharide synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) OX=1224742 GN=lpxB PE=3 SV=1
Q87MF0	5.72e-108	8	387	4	377	Lipid-A-disaccharide synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=lpxB PE=3 SV=1
A1S4Q3	3.55e-107	8	387	6	379	Lipid-A-disaccharide synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) OX=326297 GN=lpxB PE=3 SV=1
B1KNT0	1.48e-106	11	390	9	382	Lipid-A-disaccharide synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=lpxB PE=3 SV=1
B0TP70	2.84e-106	7	387	5	379	Lipid-A-disaccharide synthase OS=Shewanella halifaxensis (strain HAW-EB4) OX=458817 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000338_00793.