CAZyme Information: MGYG000000336_00549

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Varibaculum
• CAZyme ID: MGYG000000336_00549
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
496		55847.01	9.81

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000336	1244397	MAG	Sweden	Europe

• Gene Location: Start: 69; End: 1559 Strand: +

Full Sequence      

MRLGATRKLIFDETYYVKDAYSLWHFGYETNWPKGVDTKFAMGDFARATADPAFVVHPPL
GKWIIGLGMKIFGWSNPFGWRIATAICGIILVYLTCRLAWALFNSWILTGIAGMFIATDG
VAISLSRVGLLDGILAVFCLAGVLCVVYDQQRVRPKLTRQLLGAELGNDLAGVRWWLGAA
GIWLGCAGAVKWSGLYLLAVCGIFVFLRDLTLRLSALRISPRSLSNQYPGIKGKQRAWLG
AIVRGGLPAFAQLVLVAFGVYLLNWWNWFSHSRAWGHGKTASAAGHSSWLDPISDYVTYM
SEVMTFHTGVTSKHPYQSYPWQWLINQRPTSMLFEKPHGDNGDFTVEAMSSLGNPMLWWV
GVIALAVIIYCTIVRRDWRAGVILVGYLGLWAPWMLYWYRTIFMFYMVVLTPFLALAVTY
LIGLLLGLLRPLPEPLIACRDRLVPPIRRTPDFAVSMGISLVIVIFLVAVFFYPVVSGMP
IPYSHWGWRMWFSSWI

Enzyme Prediction     

No EC number prediction in MGYG000000336_00549.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	2	269	3.4e-61	0.9417040358744395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	4.24e-14	52	205	67	223	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	6.87e-09	304	493	11	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam02366	PMT	1.02e-08	54	223	42	214	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	2.01e-07	57	207	64	194	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
COG4346	COG4346	2.33e-07	57	418	136	405	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX81378.1	1.55e-137	3	496	69	547
QQT14111.1	2.05e-128	1	494	36	545
QQU09498.1	2.05e-128	1	494	36	545
ADI66786.1	2.05e-128	1	494	36	545
QGS11599.1	3.23e-116	3	496	87	581

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	2.51e-63	10	495	66	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	1.52e-62	10	495	72	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.52e-62	10	495	72	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	2.40e-48	10	495	63	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999946	0.000071	0.000009	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
77	94
101	123
128	147
241	263
355	374
381	403
413	432
453	475