CAZyme Information: MGYG000000328_01538

Basic Information

• Species: CAG-272 sp900556615
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-272; CAG-272 sp900556615
• CAZyme ID: MGYG000000328_01538
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220		24469.68	4.7359

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000328	1880403	MAG	Sweden	Europe

• Gene Location: Start: 518; End: 1180 Strand: +

Full Sequence      

MVSETRERVNAEVLFRAFITTPSGFDPAKESLPMIVFLHGAGERGDDLSLVRIHGIPKLF
GENPDYHGLRVITVSPQCPAYTVWNDVSIQLFEFILKTAEKYNADINRISITGLSMGGFG
TWELLISHSDFFSAGAPICGGGMDWRIPADMKTPVRAFHGDADPTVPVEYSKFLCKAVNE
RGDKAELTVYSGCGHDSWTEAYERTELIEWLSNSERSCLE

Enzyme Prediction     

No EC number prediction in MGYG000000328_01538.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	16	211	7.7e-21	0.801762114537445

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	2.18e-38	7	216	168	387	Predicted peptidase [General function prediction only].
COG1506	DAP2	2.91e-12	17	211	380	613	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0400	YpfH	4.33e-10	27	214	13	205	Predicted esterase [General function prediction only].
COG3509	LpqC	1.90e-09	16	167	48	205	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
pfam01738	DLH	2.80e-08	91	195	80	185	Dienelactone hydrolase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU56037.1	1.22e-45	22	216	808	1007
VTR91196.1	3.68e-39	4	217	34	240
QJW99051.1	2.53e-36	4	216	35	240
BCI61582.1	5.90e-36	22	211	832	1038
ABS60377.1	3.87e-26	30	216	35	245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	1.00e-37	12	216	157	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
4Q82_A	5.80e-22	10	216	50	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]
3WYD_A	9.02e-22	22	216	28	217	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000328_01538.