CAZyme Information: MGYG000000310_01348

Basic Information

• Species: Phascolarctobacterium_A sp900552855
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900552855
• CAZyme ID: MGYG000000310_01348
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
178	MGYG000000310_107|CGC1	21135.04	6.4764

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000310	1785527	MAG	Sweden	Europe

• Gene Location: Start: 2372; End: 2908 Strand: -

Full Sequence      

MCYGGWRFWNSDAVQTRFVYMWDYQQDIVTYSEKNKIDPFLIAAIIKNESGFNHKAVSRV
GAVGLMQIMPETGSWIAEQMGLKGYTEDQLYESRTNIRMGCWYVGELEHEFKRNMVLLLV
AYNAGRGQAKEWMEQNSWDYNFNSPEKIPYPDTREYVIKVLRDRDKYYLLYKDKINVN

Enzyme Prediction     

No EC number prediction in MGYG000000310_01348.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	34	165	1.1e-27	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.06e-73	22	166	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.02e-50	24	172	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.88e-36	39	162	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	6.09e-32	23	178	138	290	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.84e-27	31	138	4	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV76946.1	3.04e-102	3	175	33	205
BBG64618.1	5.01e-86	5	175	28	198
QNP77119.1	2.07e-85	5	175	39	209
ADB46849.1	1.60e-60	9	172	30	193
AEQ23289.1	2.06e-58	5	171	27	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.34e-23	20	171	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.35e-23	20	171	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.38e-23	20	171	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.39e-23	20	171	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.41e-23	20	171	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	2.04e-16	7	168	454	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	2.04e-16	7	168	454	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	1.29e-15	9	168	456	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	5.91e-14	20	166	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	5.91e-14	20	166	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000310_01348.