CAZyme Information: MGYG000000296_01624

Basic Information

• Species: Peptostreptococcus anaerobius
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptostreptococcus; Peptostreptococcus anaerobius
• CAZyme ID: MGYG000000296_01624
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	MGYG000000296_30|CGC1	27900.2	10.9954

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000296	1868390	MAG	Sweden	Europe

• Gene Location: Start: 931; End: 1647 Strand: -

Full Sequence      

MVKLGKSNTRTRTKKGTRNKQTANKQTTKKQTANKQTTKKQAKKYTKNYTYKKKKTTRPK
RKWFWKIIILLVLISTLYTAKSVFEFVEYQSSQSGYTMSGKDFIDKVDDIAIVEYRKSGI
LPSITVAQAILESNWGRSRLTQDANNLFGIKADSSWWGSSVTFSTGEYYNSKVNAKFRKY
RSWKHSIEDHTDFLVKNKRYERAGIFDKKDYKSQARPLKMQAMLLQRTRTVIRYMQIS

Enzyme Prediction     

No EC number prediction in MGYG000000296_01624.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	110	218	2.2e-30	0.78125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.66e-40	67	219	8	161	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
pfam01832	Glucosaminidase	5.26e-29	109	190	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	4.27e-22	116	201	168	260	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	5.07e-21	101	200	9	107	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	2.99e-18	90	203	150	270	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALP02924.1	2.22e-38	103	218	161	276
AMM58562.1	2.22e-38	103	218	161	276
AXB63823.1	2.66e-38	103	218	169	284
AVD44280.1	2.66e-38	103	218	169	284
QIF79152.1	2.66e-38	103	218	169	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	8.87e-16	103	194	33	127	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	2.06e-15	98	200	1	110	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.82e-15	98	200	1	110	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	3.22e-10	98	197	55	158	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	3.68e-10	103	204	4	112	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.73e-18	103	212	51	155	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.09e-14	99	203	159	269	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	4.78e-14	90	203	151	270	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P15931	1.47e-13	91	200	143	259	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	4.41e-12	101	200	150	256	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999123	0.000611	0.000194	0.000005	0.000002	0.000067

TMHMM  Annotations     

start	end
63	80