CAZyme Information: MGYG000000280_01370

Basic Information

• Species: AM51-8 sp003478275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AM51-8; AM51-8 sp003478275
• CAZyme ID: MGYG000000280_01370
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	MGYG000000280_2|CGC12	37509.85	7.9888

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000280	2599910	Isolate	China	Asia

• Gene Location: Start: 561854; End: 562888 Strand: +

Full Sequence      

MNIGGHDPNKGGLVSIIGSAGSQVCGAAGETTTHVKDFPSLVMADGPAGLRLAREYYRDE
KGLHAVGQAGIPESFMDYMPKPMLFFSKLIMGGNKGPKAGTEVKTQYCTAIPIGTAIAQS
FNTDLAEKYGDIVGYEMEMFGVHLWLAPALNIHRSIRCGRNFEYYSEDPLVSGLMAAGIT
NGVQKHPGCGTTIKHYAANNKELNRYANNSHVSERAMREIYTKGFGICVKKSQPHAVMTS
YNLLNGVHTAENRGLIEDILRCEYGYEGIVMTDWVVPMTADKRSANRNSLARFVAAAGGD
LFMPGGKSDYEDLKKGIQEGDVSEEQVRINATRVLKMARKLVEK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	42	304	4.7e-58	0.9398148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.33e-44	109	341	81	315	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.61e-23	109	335	86	314	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	2.12e-15	109	273	118	287	beta-glucosidase BglX.
PLN03080	PLN03080	1.12e-13	109	273	112	297	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFJ55305.1	3.05e-151	1	342	462	802
AFN84577.1	2.11e-131	1	343	468	808
QRT50987.1	1.46e-117	1	338	468	799
VCV22858.1	2.10e-117	1	338	468	800
CBL11427.1	2.10e-117	1	338	468	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	1.44e-61	12	337	24	303	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.00e-60	12	337	24	303	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WUG_A	3.66e-41	109	303	584	778	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5WAB_A	1.54e-40	109	274	69	233	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	1.23e-36	39	274	38	232	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5BFG8	4.30e-42	93	341	51	289	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P27034	7.42e-42	88	335	38	274	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
P16084	1.94e-41	93	274	591	770	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	4.98e-40	110	343	534	774	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
F6C6C1	2.20e-39	109	274	69	233	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000280_01370.