CAZyme Information: MGYG000000280_01079

Basic Information

• Species: AM51-8 sp003478275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; AM51-8; AM51-8 sp003478275
• CAZyme ID: MGYG000000280_01079
• CAZy Family: GT35
• CAZyme Description: Maltodextrin phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	MGYG000000280_2|CGC5	64643.22	5.7324

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000280	2599910	Isolate	China	Asia

• Gene Location: Start: 282532; End: 284232 Strand: -

Full Sequence      

MDALEIKVKDTFGTDPGHVTNEQIYVALLELVKEEAEKKVTTEGKKKLYYISAEFLIGKL
LSNNLINLGLYDEVEACLQKYGKTMAEIETIEPEPSLGNGGLGRLAACFLDSIATLGLNG
DGVGLNYHFGLFKQVFENNLQQETPNPWIENKNWLTKTKRTYDIEFGGLTLTSCMYDIDV
VGYMGRTTKLHLFDIDSVDESLVKEGIDFDKTDIAKNLTLFLYPDDSDEDGRILRVYQQY
FMVSNAAHLILDEALERGSNLHDLADYATIQINDTHPSMVIPELIRLLMQKGIRMEEAIE
IVTKTCAYTNHTILAEALEKWPIHYLQKAVPQLLPIIYELNNKVNDTFHDPSVAIIDAED
RVHMAHMDIHYGYSVNGVAYLHTEILKNSELNNFYKIYPEKFNNKTNGITFRRWLLHCNH
PLADLLTELIGDGYKKDATELEKLSAYADDTAVLEKLLAVKQGKKEELASYLKQTQNIAI
NPDSVFDIQIKRLHEYKRQQMNALYVIDKYFEIKEGKLPKRPITVIFGAKLLRLMSLQKT
LSMSSSAYKRSLPMTRRYLHTCPLSW

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	78	530	9.7e-142	0.6780415430267063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0058	GlgP	0.0	1	530	10	531	Glucan phosphorylase [Carbohydrate transport and metabolism].
TIGR02093	P_ylase	0.0	7	530	4	574	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	7	530	7	575	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00343	Phosphorylase	0.0	78	530	1	442	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
PRK14985	PRK14985	5.12e-144	27	530	41	576	maltodextrin phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN95921.1	5.60e-290	1	530	1	529
ADF57356.1	1.30e-287	1	530	1	529
CBL08110.1	9.61e-287	4	530	16	542
VCV23296.1	5.33e-286	4	530	25	551
CBL12671.1	5.52e-286	4	530	16	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L22_A	4.07e-226	8	530	12	536	Crystalstructure of putative glycogen phosphorylase from Streptococcus mutans [Streptococcus mutans UA159]
2C4M_A	3.08e-119	8	530	17	563	Starchphosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_B Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_C Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_D Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae]
2FFR_A	8.48e-110	11	530	27	597	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
5OX0_A	2.50e-109	11	530	39	609	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
7P7D_A	3.67e-109	11	530	32	602	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29849	2.04e-247	1	530	1	531	Maltodextrin phosphorylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malP PE=3 SV=2
P39123	8.75e-115	35	530	50	574	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
P79334	1.76e-109	11	530	39	609	Glycogen phosphorylase, muscle form OS=Bos taurus OX=9913 GN=PYGM PE=1 SV=3
O18751	2.47e-109	11	530	39	609	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3
P00489	3.76e-108	11	530	39	609	Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000280_01079.