CAZyme Information: MGYG000000273_02807

Basic Information

• Species: Phocaeicola coprophilus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprophilus
• CAZyme ID: MGYG000000273_02807
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557	MGYG000000273_43|CGC1	63207.38	5.3765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000273	3492533	Isolate	China	Asia

• Gene Location: Start: 58; End: 1731 Strand: +

Full Sequence      

MLYYMPLPEIDLDEAKVEIVRLKHLIEFNGTKENPVRGIHLQGLTFKHTARTFMENKEQL
LRSDWTMYRGGAIVFNGAEECSVENCEFDHLGGNTIFVNNYNRYLTVRGCYIHHSGANGI
VFVGDPDMVRSPLFRYGNQNYETMDMTPGPWGDNYPQDCWVDDCLITMTGRDEKQTAPVQ
ISMSQRIRVSHCSIYDVPRAGININEGTFGGHVIEFCDVFNTVLETGDHGSFNSWGRDRF
WTPDVVTISDQVALHPDMQYWDVLEPNVLRYNRWRCDHGWDVDLDDGSSFYRIYCNLLLN
GGLKMREGYDRVATNNIILNNSLHPHVWVRNSDDVFKHNIVFTAYQPAVMNSALGESDRW
GKELDYNLFATGQAAMRKFAAHGADAHSVSADPLFVNPGQGDFRVRPESPAFKIGFRNFD
MTDFGVKSEKLKKLARTPDIPEIVLQIQDEVSAEYTWLGAVLKEVKGEELSAYGAKFSQA
SMALDRVPAESEAYKLGLRSGDLLLSFGGKEISTAASFKQLLEEYARKSGELLVMRNQKE
MVVKLAAFRGEMQPVER

Enzyme Prediction     

No EC number prediction in MGYG000000273_02807.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	2	207	5.1e-25	0.3984819734345351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	1.77e-09	70	221	23	136	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd00987	PDZ_serine_protease	7.17e-09	457	545	2	90	PDZ domain of trypsin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
cd00989	PDZ_metalloprotease	9.29e-06	484	545	16	77	PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
pfam17820	PDZ_6	1.38e-05	489	536	7	54	PDZ domain. This entry represents the PDZ domain from a wide variety of proteins.
COG0265	DegQ	0.001	438	551	231	344	Periplasmic serine protease, S1-C subfamily, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW32784.1	2.55e-144	2	522	259	773
QDT08270.1	3.28e-21	17	430	285	720
QDU37998.1	1.36e-20	17	426	288	719
QDV88786.1	2.90e-20	2	442	278	697
QEG43124.1	3.22e-20	18	436	286	726

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000273_02807.