CAZyme Information: MGYG000000268_01328

Basic Information

• Species: Schaedlerella sp900066545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella sp900066545
• CAZyme ID: MGYG000000268_01328
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728	MGYG000000268_4|CGC2	84323.5	5.4542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000268	3370693	Isolate	China	Asia

• Gene Location: Start: 71999; End: 74185 Strand: +

Full Sequence      

MSKTENLQQKLVRIVREEGVKTAYRKGKNYIKLRVSGDPIRHCYKDVLFINGCYLPHPSR
YRVDHQVEQLQAFGLTVDSMFYERVNLEILKYYRAFVFFRCPITTEIEEFIDRAKYYNKP
VIFDIDDLVIDKKYTDMIPYLKTMSENDKKVYDDGVERTKQTLLKCDCAITTTSVLANEL
RNYVDDVYINRNVASEKMLKYSKRAYSNVVKDENKIIMGYFSGSITHNADFELIMPVIKE
IMEKNEQVYLKIVGELDLPKELDSVRERVIAEPFVEWKKLPELIASVDINLAPLEESIFN
AAKSENKWLEAGLVHVPTIASKVGAFEEMIQDGQDGILCANIHEWQEKLQLLIDDKTYRE
EIGSNAYAITRKKITTYTGRGIAEYVISKMPKNFGFVLPTTNISGGVNVIIKHCNMLRDH
GYDVFIVNEDRKSDDIINKDGRIPVVQSYDTRFEAYVDTLVASLWSTLTFVKVYPNVLHR
AYLVQNFETNFSPDGYFEKTMANATYNSLIPIHYLTISKWCQDWLKEKFGKDSIYVPNGI
DLGVFSYKERNFEGKIKILIEGNSDDHYKNVDESFKIAEKLDKDKYEIYYLSYQGGAKSW
YRVDKFLQRVPHDEVGKIYQSCDILLKTSILESFSYPPLEMMATGGLAVVAPNGGNIEYL
RDEENCLMYKLGDIDKAVEQIDRLAEDALLRERLIAGGLETAKKREWSKIEEQIVTMYRD
LKENADEY

Enzyme Prediction     

No EC number prediction in MGYG000000268_01328.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	5.50e-32	402	719	12	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03794	GT4_WbuB-like	9.16e-21	114	368	119	375	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	1.38e-19	506	724	146	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	5.70e-16	47	373	2	351	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00534	Glycos_transf_1	2.13e-15	567	705	13	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQV05331.1	5.51e-293	10	718	12	722
AFH59669.1	1.54e-287	5	718	4	722
ANF98440.1	3.24e-282	7	728	6	742
QDY84365.1	6.99e-279	10	727	9	738
QOT09872.1	1.36e-271	15	728	14	733

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59002	2.18e-06	606	719	268	382	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
D3Q051	2.49e-06	606	720	312	426	D-inositol 3-phosphate glycosyltransferase OS=Stackebrandtia nassauensis (strain DSM 44728 / CIP 108903 / NRRL B-16338 / NBRC 102104 / LLR-40K-21) OX=446470 GN=mshA PE=3 SV=1
O07147	3.65e-06	515	721	145	363	Phosphatidyl-myo-inositol mannosyltransferase OS=Mycobacterium leprae (strain TN) OX=272631 GN=pimA PE=3 SV=1
A1SP12	7.77e-06	596	719	325	448	D-inositol 3-phosphate glycosyltransferase OS=Nocardioides sp. (strain ATCC BAA-499 / JS614) OX=196162 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000268_01328.