CAZyme Information: MGYG000000235_00396

Basic Information

• Species: Enterobacter kobei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter kobei
• CAZyme ID: MGYG000000235_00396
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000000235_1|CGC5	43604.95	6.1297

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000235	4917845	Isolate	China	Asia

• Gene Location: Start: 418344; End: 419486 Strand: -

Full Sequence      

MMKVWPVKHSPLLRQPERFIARDELKALIQKVTHNLVNIHDKTGEFLLRLDDGRVIDTKG
WVGWEWTHGVGLYGIWQYYCQTGDTGMRDIIDSWFADRFAEGATTKNVNTMSPFLTLACR
YEETKNPAWLPWLESWAEWAMTEMPRTDHGGMQHITLAEENHQQMWDDTLMMTVLPLAKI
GKLLNKPEYVEEAVYQFLLHVQNLMDRETGLWFHGWSYDGNHNFARARWARGNSWLTIVI
PDFLELIDLPENNAVRRYLVQVLNAQIAALAKCQDESGLWHTLLDDSGSYLEASATAGFA
YGILKAVRKRYVAPAYADVAEKAIRGIVKNISPEGELLQTSFGTGMGSDLAFYRQIPLTS
MPYGQAMAILCLTEYLRKYF

Enzyme Prediction     

No EC number prediction in MGYG000000235_00396.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	62	377	9.4e-116	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.28e-142	30	380	2	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.44e-125	38	379	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBV82215.1	3.61e-291	1	380	1	380
QZS49613.1	2.01e-290	2	380	1	379
AOP89259.1	8.18e-290	2	380	1	379
QEO03564.1	1.65e-289	2	380	1	379
QMT08700.1	9.55e-289	2	380	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.25e-247	4	380	5	381	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.39e-240	3	380	5	382	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	5.91e-160	24	379	7	372	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	9.49e-22	186	358	222	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.60e-45	64	377	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	3.00e-11	181	308	10	143	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.00e-11	181	308	10	143	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000235_00396.