CAZyme Information: MGYG000000229_00819

Basic Information

• Species: CAG-317 sp000433215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-317; CAG-317 sp000433215
• CAZyme ID: MGYG000000229_00819
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000000229_2|CGC3	54809.59	4.634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000229	2785689	Isolate	China	Asia

• Gene Location: Start: 249420; End: 250838 Strand: -

Full Sequence      

MNALTRDLIKLTDIAETQGAEKEEKLLFREHFHLMPPVGWLNDPNGLCQFEGVYHAFFQY
SPFDAEGGVKMWGHYISDNMLDWKYQGVALYPDQPFDCHGVYSGSALVEDGKMYLYYTGN
VKLEDGEYDYIRTGREGNTVLVSSEDGIHFGHKKQLMRNTDYPDDLTCHVRDPKVWKEQD
TYYMVQGARTKEDVGQILIFTSKDKVNWKFKSRIESKEPFGYMWECPDYFTIGDKKILSA
SVQGLEGGIWEERNVYQSGYFEVEGDILSSYKLGEYKLWDYGFDYYAPQSFETEDGRRIH
ISWMGMPDCEAYTNLTIADGWQHCFTLPREIYVKDGKICQRPIRELDYKEAITKIAENKL
QADSCKAYDLKIDKIQNNQFCIALAEELLLEYTDGRFRMRFTDNRKTCVSAGRDCRYVET
DEVTNIRVIADVSSVEVFVNDGEYVFSTRYYPDKYNINVQAEGADICLAEIK

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	33	342	1.9e-89	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	2.90e-154	39	335	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	3.36e-138	18	453	3	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	1.22e-130	28	460	28	467	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	7.53e-110	33	342	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	4.20e-108	33	442	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34775.1	8.19e-276	1	471	1	475
CBL24955.1	7.65e-269	1	472	1	474
QRT48577.1	7.31e-260	1	472	1	474
QHB24857.1	7.52e-249	1	471	1	468
QEI32364.1	7.52e-249	1	471	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	1.42e-74	32	452	29	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.64e-66	28	453	48	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.43e-65	28	453	48	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	4.59e-59	28	456	32	467	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
1UYP_A	3.55e-58	27	457	1	412	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	9.80e-101	18	463	14	465	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P16553	3.25e-84	32	470	27	469	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
A1STJ9	8.51e-82	28	463	95	526	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1
P40714	4.38e-81	28	452	24	450	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P27217	9.90e-80	32	452	30	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000229_00819.