CAZyme Information: MGYG000000227_02352

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_02352
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1636		182199.33	5.7763

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 256170; End: 261080 Strand: -

Full Sequence      

MNNFSISQEAATTAAQSTGSAWKEQEKYSDSLQARINRLSNAWTELSLAAGDAVISDGIV
ALTESLKGLVQVGADITKTIGFLPQVLGAATTAFLLFNSTLRTSTLASGRQLIELFSTLP
ARIRTFSISTVTARTSIEALKISFATLGTTAKAAGAFLAGAALPIAAFMAIGFAIEKIVS
AFSEAKQKQEEFEESQRKSVEAITTNKEQTDQLIKKYQELQKAKDKGTLSADQEQEYLQV
TQQLSQTFPNLIQGYDDQGNAIIKNNDALKEAIEYTKQLADLNKEDIRNNSKKTFEDSLN
NIQKLKDEIKSYQQISKQMDKMSDSKNRNIFDTITNPFMSDLDYKNEANKYEKEAIRAQQ
DLSSVAAKIREDVLQTIDAFNTAEINPEVTKSLKDAFNAIDFTKLEPEELDSFSRRVASL
MSDIQNALDKGDKNAFEKANSGLQQLLSTYGSGKPAIDDFSLSYEDLKNTAKDATVVWDE
NGEGVNELTGEVEELSQKLKDAKGDIEAIQSVISDLVDSKQDDLAISALQNEAYDTFADS
ISPLNELLEKMAEGKSISATEAQKLVQKEKDLAGAISIENGVVKLNRDAIVKLRDAKLKA
YNDMQQSVKQDLLNQANATVKKIKNYGLEVKSIQTVADAQANLSKMRKQVDTLMESGNIQ
MAMPIIKEITELSDVTGQLEDLDKMADLANSSLNEVGTSLETYSDEQEKASSETEKSKYV
VDKYKEALEKVNAEIEKFNKQTNDYPKWSQKYRDAINKEIKALERKKKLMQDQIKLLKQQ
IKSGYIPQTGLVTSSSSSGSSSGSYYSGGSYSGKYSSYINAAASKYGVDPALIAAIIKQE
SNFNAKARSTVGAMGLMQLMPSTAKSLGVNNAYDPYQNIMGGTKYIAQMLNKFGGNIEKA
LAAYNAGPGNVIKYGGIPPFKETQNYVKIILSNYNKSLSSATSKIANYYTSANGFRISSK
FGAKESGLRSSPHKGLDLAAKAGTPVKAVRAGKVITATYSKTAGNWVVIQQDDGTVAKYM
HMQKGLKVKKGDVVSAGQTIGKVGSTGHSTGNHLHLQIEQNGKPIDPEKYMKGLTSDLSQ
SEAERQQAIAQAKSDLISLQGDLDSVNDQIQELQYELVQSKLDEFDKRKSDLEVKIAKNE
SLAKRYLTDSKEFRKYTNEQKKAVDEQRKIQQEKLNWINKELKTNKKLNYAQRDQLREEL
KQAKLDLISLEDQVRELQGQLVQSKVDQVLNNIEKSVKKTEGKLKDVDIKIQMTEDDNQK
VKYYSQQVKLIQQQQAEAKKYIKQLEEQKKAAKGFPDIQKQITEEIENWKDKQKDYNLEL
YNTKKSIKDIYKSLADEVVSIYKEMYEKMRDIELEAHRKATQNIIDEIDKEDDEAKFQKS
LKEKQESIQETKDQINKLSLDDSDEAKAKLKDLDKQLQEQEQDLEEFLKDRENTKRKEAL
QDQLEKDEESINKKYDDLVNDDRAFKELEKKLLDGKITDIAKQLNEFTKFINSNMDSIGK
SISNNLIDKLKEASNALNVVIAGNKTGKKVSSFDVGGYTGKWGSSGKLAMLHEQELVLNK
SDTSNVLKIVELTRNIFGDIPTKATLPSPFTAPNQTTSNQTININFNVDKMTGSKADAEK
FLGEVYNIASARGVKI

Enzyme Prediction     

No EC number prediction in MGYG000000227_02352.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	828	942	2.8e-34	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.58e-52	830	935	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.31e-48	819	934	10	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.28e-45	819	936	8	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01551	Peptidase_M23	1.08e-40	971	1067	1	96	Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.
pfam01464	SLT	4.72e-40	819	926	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATH91571.1	0.0	1	1634	1	1634
ARC67799.1	0.0	1	1636	83	1718
QAT65189.1	0.0	1	1634	123	1744
ASB89409.1	0.0	23	1636	2	1621
QDL79394.1	0.0	1	1636	1	1633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2HSI_A	1.69e-15	957	1067	162	273	Crystalstructure of putative peptidase M23 from pseudomonas aeruginosa, New York Structural Genomics Consortium [Pseudomonas aeruginosa PAO1],2HSI_B Crystal structure of putative peptidase M23 from pseudomonas aeruginosa, New York Structural Genomics Consortium [Pseudomonas aeruginosa PAO1]
4QP5_A	5.99e-15	953	1072	13	137	Catalyticdomain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the presence of phosphate [Staphylococcus simulans bv. staphylolyticus],4QP5_B Catalytic domain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the presence of phosphate [Staphylococcus simulans bv. staphylolyticus],4QPB_A Catalytic domain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the absence of phosphate [Staphylococcus simulans],4QPB_B Catalytic domain of the antimicrobial peptidase lysostaphin from Staphylococcus simulans crystallized in the absence of phosphate [Staphylococcus simulans]
6UE4_A	8.88e-15	955	1082	245	374	ShyAEndopeptidase from Vibrio cholerae (Closed form) [Vibrio cholerae O1 biovar El Tor str. N16961],6UE4_B ShyA Endopeptidase from Vibrio cholerae (Closed form) [Vibrio cholerae O1 biovar El Tor str. N16961]
6U2A_A	9.09e-15	955	1082	242	371	ShyAendopeptidase from Vibrio cholera (open form) [Vibrio cholerae]
5NMY_A	6.07e-14	953	1072	11	135	NMRsolution structure of lysostaphin [Staphylococcus simulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	0.0	1	1574	598	2184	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	0.0	1	1574	598	2184	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	4.34e-46	817	934	62	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P27380	3.54e-21	819	935	11	120	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q89AI9	1.61e-16	955	1067	230	344	Uncharacterized metalloprotease bbp_296 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) OX=224915 GN=bbp_296 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999866	0.000200	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
153	175