CAZyme Information: MGYG000000222_02617

Basic Information

• Species: Parabacteroides sp003473295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003473295
• CAZyme ID: MGYG000000222_02617
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		43275.22	9.2961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000222	4189286	Isolate	China	Asia

• Gene Location: Start: 46789; End: 47925 Strand: +

Full Sequence      

MKYFLIAGEASGDLHASNLMAALKEVDKEADFRFFGGDLMQAVGGTLVKHYREMAFMGFI
PVLLNLRTILKNMKTCREAIRSYRPDVVILIDYPGFNLKMARFVKTELHLPVYYYISPKI
WAWKQYRIKDFRRYVDRMFCILPFEKEFFNRLDYAVDYVGNPSVDSVAQFQAQQAASQPD
TFLKDEGLGEKPILALLAGSRRQEIKDNLPTMLEVAASFPDFQPVIAGAPGLETEYYRPY
IGNHTPKIVFGRTYPLLQHSRAALVTSGTATLETSLFRVPQVVCYYTPVGRLVSFVFHHF
FHIPYISLVNLIGGREIVQELFGARFSKRQIQDELGRILHDAAYRKQMLDGYDEIIRLLG
KPGASRRAAELIYLSLNH

Enzyme Prediction     

No EC number prediction in MGYG000000222_02617.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	1.5e-108	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.02e-101	1	372	2	371	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.08e-89	1	372	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.19e-68	4	371	2	370	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.27e-55	5	370	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.77e-42	1	373	2	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50508.1	6.74e-224	1	378	1	377
ABR44355.1	2.90e-218	1	376	1	375
QRO15504.1	2.90e-218	1	376	1	375
BBK92630.1	2.90e-218	1	376	1	375
QCY57761.1	2.90e-218	1	376	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.46e-33	5	372	11	377	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.46e-33	5	372	11	377	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.45e-70	2	372	6	374	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2IL69	3.14e-60	2	370	10	376	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
Q2LVL8	1.72e-59	5	369	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B8JE78	1.87e-58	2	370	10	376	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	1.03e-57	2	370	10	376	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000222_02617.