CAZyme Information: MGYG000000222_01895

Basic Information

• Species: Parabacteroides sp003473295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003473295
• CAZyme ID: MGYG000000222_01895
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676		77873.69	5.4432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000222	4189286	Isolate	China	Asia

• Gene Location: Start: 39104; End: 41134 Strand: -

Full Sequence      

MKCKVILSLLIMSFLFSFPQKGTADNPLYSNNRYPLIQKPYMELPLGNIKPQGWLLEMLE
RQKKGASSQMDILYPEVMGPRNGWLGGDGDQWERGPYWIDGLLPLAYILDDKELKQKVQP
WIEWTLKSQRADGFFGPAKDYGPEPGIQRDNSADWWPRMVMLKIMQQYYSATGDKRVIDF
MTRYFQYQLETLPSTPLGRWTFWAEYRACDNLQAVYWLYNITGDNFLLDLGNLLHEQSYD
FVDMFLNRNDLTRFNTIHCVNLAQGIKEPIIYYQQNPERKYIDAVKKGFADIRQYNGQPQ
GMYGGDEGLHGNNPTQGSELCSAVELMYSLEKMMEITGDLAFTDHLERIAFNALPTQITD
DFMDKQYFQQANQVMITRHAHNFYENNSHAETDIIYGTRTGYPCCFSNMHQGWPKFVQSL
WYATPDNGIAALVYSPSEVTALVGNGNKIKITEDTYYPMDDKIQLAIQLLDKKVKEVTFP
LHLRIPGWCKEATVTINGIAETTAKGNSVAVIRRTWKSGDQIVLHLPMEVSTSRWYENSI
AIERGPLVYGLKMEENWVKKEFKGNEITQFGKDYYEVTSPTKWNYGILASTLGKMQENFQ
VTIDKDKQAGTYFWNVENAPIQIKAKAKEIPSWQSYNEMAGPLPFSVNNSNQSVEEITLI
PYGCTTLRISEFPLVW

Enzyme Prediction     

No EC number prediction in MGYG000000222_01895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	318	549	2.3e-35	0.42366412213740456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.19e-58	97	549	62	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.83e-30	111	563	84	520	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARS39276.1	1.19e-165	32	675	29	648
ATP55412.1	2.16e-164	18	675	19	651
QDW25584.1	8.74e-163	32	675	31	650
QNK64903.1	8.74e-163	5	675	1	645
QHS59113.1	1.74e-162	18	675	17	651

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	3.12e-21	98	556	82	566	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.66e-19	98	556	82	566	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.62e-18	88	552	100	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999073	0.000222	0.000156	0.000147	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000222_01895.