CAZyme Information: MGYG000000215_01072

Basic Information

• Species: Prevotella stercorea
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella stercorea
• CAZyme ID: MGYG000000215_01072
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		39614.02	8.7477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000215	3117648	Isolate	China	Asia

• Gene Location: Start: 3386; End: 4444 Strand: +

Full Sequence      

MVDKVNGGTKADAVNAGLNVISTPYFINTDVDCILSKDAMYQCIFPVIMDETIIAVSGTM
SMSNGSTLHDGKLVDIRPSSRPVPLFQDLEYKRSFLVGKMGWSKINAMNNVSGGYGLFST
EVVINAGGYSSSSFAEDMDMITRMIAYCCDFNRKYRVVQIPHTCCWTEGPSTLHMLYRQR
TRWGRGLIQTMWEHRRLLFNPKYKRLGVITMSYTFLFEFLAPIIEFFGTIMIVYLAFTGG
VNWSTFFVTYFAIYVFSFMLSAFVVFYDYLLGCSYTSVRSYLKLLLAAALEPIVYHPIIV
VCSLVGYFKYITRQKAVWVSMERTGVKHATVPAGGSQPAQQSAPQPNANQSN

Enzyme Prediction     

No EC number prediction in MGYG000000215_01072.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.25e-30	2	137	59	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.86e-27	6	318	121	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	1.22e-17	10	328	122	420	N-glycosyltransferase; Provisional
PRK14583	hmsR	7.98e-15	10	323	143	437	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
pfam13632	Glyco_trans_2_3	4.27e-07	113	237	74	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40240.1	3.32e-134	1	336	143	479
QGT72810.1	3.32e-134	1	336	143	479
QDM10776.1	3.32e-134	1	336	143	479
QUR45204.1	3.32e-134	1	336	143	479
SCV07454.1	3.32e-134	1	336	143	479

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.66e-07	7	231	119	319	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999659	0.000374	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
215	237
244	266
286	308