CAZyme Information: MGYG000000206_01884

Basic Information

• Species: Lachnoclostridium_B sp900066555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium_B; Lachnoclostridium_B sp900066555
• CAZyme ID: MGYG000000206_01884
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275		30213.89	6.4538

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000206	2952936	Isolate	China	Asia

• Gene Location: Start: 197025; End: 197852 Strand: +

Full Sequence      

MELIKAIMMQESGGRGLDPMQCSEGSFNTKYPKQPNGITDPEYSISCGVQEIKSCLERAG
VKNPLDMENIKLALQSYNYGNGYLEWAKARGGYTLANAAEFSDMMAQRMGWSSYGDKQYV
PHVLQYYAFGRIPTGIGNQAIVQVAASQEGKGGTTYWRWYGFGGRVEWCACFVSWCADQS
GYIQSGVIPKFSLCSDGVKWFESKGRFRDGSYTPVAGDIIFFDWGNNGTIDHVGIVESVS
GGTVNTIEGNSGDKVARRSYRIGSSNIYGYGVPAY

Enzyme Prediction     

No EC number prediction in MGYG000000206_01884.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	1.22e-46	2	128	19	151	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	2.96e-37	2	127	25	165	Lysozyme-like.
pfam05257	CHAP	2.27e-17	160	250	1	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
cd00254	LT-like	5.12e-08	2	128	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
TIGR02594	TIGR02594	1.15e-05	124	270	7	127	TIGR02594 family protein. Members of this protein family known so far are restricted to the bacteria, and for the most to the proteobacteria. The function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT31183.1	1.90e-200	2	275	300	573
QDW73624.1	2.29e-148	2	275	326	600
CBK79184.1	8.77e-141	2	275	50	325
AMP52273.1	1.71e-140	2	275	49	324
AMP53908.1	1.84e-139	2	275	118	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	3.00e-07	3	235	46	272	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	7.65e-06	4	235	49	276	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	1.43e-26	3	235	79	293	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
O34636	8.83e-10	3	108	74	171	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000206_01884.