CAZyme Information: MGYG000000204_01690

Basic Information

• Species: Eubacterium_G sp000435815
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_G; Eubacterium_G sp000435815
• CAZyme ID: MGYG000000204_01690
• CAZy Family: CBM56
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	MGYG000000204_6|CGC4	90628.53	7.5583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000204	2669364	Isolate	China	Asia

• Gene Location: Start: 144889; End: 147378 Strand: +

Full Sequence      

MKFKISKKLLATVLAIAMVVTGFGINNTSKTTKAASLGSSGDYEVTAEEISSSVCKINFN
SKNYAAYAILHYKVNDGAQQNVTMSGSDKQFQYSINGLKKGDKLTCVFTYNKGNAQYDTS
EMTYVTGSTSSTDANIQAPFGLVVNSPKDNTVSVVWGRGNIDSYNVYIDNDKVANKVTCG
YYEYGNISAGTHTVSVTTVSGSRESAKTSLSVTVKGQTQQVTTAAPTTTTAEKGVVYIYQ
DINYGGRVAALNEGRYNLAALQAKGFKNDDLSSLKVASGYEAILYYDDNFQGESRRITSD
TAWIGSDFNDRTSSIIVQKKTVETTTTVKATEKENTDTGIAKPFGLVVSNPSAGTIGVVW
GRGNINSYNVYIDGNKVASKVGCAYYTYSGYSQGTHTVAITTVSGNKESAKETMTVNVAQ
SGSGQAPATTKAPATTKPATTTPSTSIGTDVPQLDSSIPVRSDKMFLQLNNKTNGKYKDS
EIYWIVLGRNKNHEICYLDAQGNLVKASESLNTVTKNGRKCANVAHSMAEAKYVYLPDIE
SGRMYLSYGEPVYVTFINGADGKVGYAGPDLNNPSDPNSDVLFEFAEFTVTNKEYWGNTT
RVDFFSFPVVTRLVGQGGFDNRPGDYPTYDKTVGDIGTRDQIFNAWKNSAPAAWKSLYDG
KRIMAPCKTTFNEGKENGHYFDNYINEFWNKYSNETLVFRCDAGTFRGRVSGDHMTFTKD
GDGGTYTIYKPTTQDVLEGKGNFNRGNSTELVIEAQLCAAFNRGVATDPANYQNPSAYYK
NGTYNYYSKFLHERSVNNFSYGFCYDDVNDQSTLLHYTNPTALILDLKW

Enzyme Prediction     

No EC number prediction in MGYG000000204_01690.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH64	465	827	7.7e-101	0.9863760217983651
CBM56	10	132	8.1e-25	0.7610062893081762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09214	GH64-like	1.67e-103	467	827	3	318	glycosyl hydrolase 64 family. This family is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain, and in the Salinispora tropica CNB-440, coagulation factor 5/8 C-terminal domain (FA58C) protein, they are positioned C-terminal of two FA58C domains which are proposed to function as cell surface-attached, carbohydrate-binding domain. This FA58C-containing protein has an internal peptide deletion (of approx. 44 residues) in the LPHase domain II.
pfam16483	Glyco_hydro_64	2.11e-94	467	827	5	370	Beta-1,3-glucanase. Family 64 glycoside hydrolases have beta-1,3-glucanase activity.
cd09216	GH64-LPHase-like	5.12e-54	473	827	6	352	glycoside hydrolase family 64: laminaripentaose-producing, beta-1,3-glucanase (LPHase)-like. This subfamily is represented by the laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis and related bacterial and ascomycete proteins. LPHase is a member of glycoside hydrolase family 64 (GH64), it is an inverting enzyme involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. LPHase is a two-domain crescent fold structure: one domain is composed of 10 beta-strands, eight coming from the N-terminus of the protein and two from the C-terminal region, and the protein has a second inserted domain; this cd includes both domains. This protein has an electronegative, substrate-binding cleft, and conserved Glu and Asp residues involved in the cleavage of the beta-1,3-glucan, laminarin, a plant and fungal cell wall component. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. Also included in this family is GluB , the beta-1,3-glucanase B from Lysobacter enzymogenes Strain N4-7. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain. In the Cellulosimicrobium cellulans, glucan endo-1,3-beta-glucosidase, they are positioned N-terminal of a RICIN, carbohydrate-binding domain.
cd09220	GH64-GluB-like	1.90e-44	534	824	68	365	glycoside hydrolase family 64: beta-1,3-glucanase B (GluB)-like. This subfamily is represented by GluB, beta-1,3-glucanase B , from Lysobacter enzymogenes Strain N4-7 and related bacterial and ascomycete proteins. GluB is a member of the glycoside hydrolase family 64 (GH64) involved in the cleavage of long-chain polysaccharide beta-1,3-glucans, into specific pentasaccharide oligomers. Among bacteria, many beta-1,3-glucanases are implicated in fungal cell wall degradation. GluB possesses the conserved Glu and Asp residues required to cleave substrate beta-1,3-glucans. Recombinant GluB demonstrated higher relative activity toward the branched-chain beta-1,3 glucan substrate zymosan A than toward linear beta-1,3 glucan substrates. Based on the structure of laminaripentaose-producing, beta-1,3-glucanase (LPHase) of Streptomyces matensis, which belongs to the same family as GluB but to a different subfamily, this cd is a two-domain model. Sometimes these two domains are found associated with other domains such as in the Catenulispora acidiphila DSM 44928 carbohydrate binding family 6 protein in which they are positioned N-terminal of a carbohydrate binding module, family 6 (CBM_6) domain.
pfam00030	Crystall	6.59e-04	282	317	2	38	Beta/Gamma crystallin. The alignment comprises two Greek key motifs since the similarity between them is very low.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI66982.1	4.51e-144	452	829	99	477
AJG99223.1	1.14e-105	49	829	34	589
CUU48451.1	4.38e-105	49	829	34	589
ABR34974.1	4.38e-105	49	829	34	589
QUF72014.1	4.38e-105	49	829	34	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H4E_A	1.66e-100	459	829	3	375	Crystalstructure of a beta-1,3-glucanase domain (GH64) from Clostridium beijerinckii [Clostridium beijerinckii NCIMB 8052]
5H9X_A	1.49e-63	443	829	116	444	Crystalstructure of GH family 64 laminaripentaose-producing beta-1,3-glucanase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5H9Y_A	1.04e-62	443	829	116	444	Crystalstructure of GH family 64 laminaripentaose-producing beta-1,3-glucanase from Paenibacillus barengoltzii complexed with laminarihexaose. [Paenibacillus barengoltzii]
3GD0_A	1.00e-27	541	827	79	363	ChainA, Laminaripentaose-producing beta-1,3-guluase (LPHase) [Streptomyces matensis],3GD9_A Chain A, Laminaripentaose-producing beta-1,3-guluase (LPHase) [Streptomyces matensis]
3HZB_A	1.99e-18	235	317	2	84	Crystalstructure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_B Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_C Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_D Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_E Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_F Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_G Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101],3HZB_H Crystal structure of a betagamma-crystallin domain from Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22222	1.49e-23	534	827	105	394	Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans OX=1710 PE=1 SV=1
Q59146	3.50e-23	534	827	105	394	Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) OX=79671 GN=glcI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001485	0.993776	0.003783	0.000388	0.000282	0.000238

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000204_01690.