CAZyme Information: MGYG000000195_02758

Basic Information

• Species: Faecalibacterium prausnitzii_E
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_E
• CAZyme ID: MGYG000000195_02758
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MGYG000000195_11|CGC1	55365.54	4.7533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000195	3389403	Isolate	China	Asia

• Gene Location: Start: 25123; End: 26637 Strand: -

Full Sequence      

MAQFVNLNPGSLRELHIGNERLVSYNVEMTEVTGGTFWKAYTPAQIAGTEPFVLKGGFLG
NATASTDLMQYYDPIDLSDKKLRKLAKEIGPAWVRVSGTWSTKTYYDFDGHTNGVIPEGY
NAILTREQWLGVLDFCKDIGAKLLISVADCEGLHHADEPWNPSQAEQIFALSKEYGKAID
AAEFVNEPNLLAMSGCPKGYTAEQYVRDQDIFIRWLHENYPDCPFVGPCSTEGVLKKHGE
KAQGGGVGDILPQCSTDDLMKGAQEKLDVYSYHYYNGVSERLEPVMPFAHWKADKAHTEE
YLAVASNMAKFHAEKRDIYCLGGEMWVTEAGDAGGGGDTWASTYLDVFRTLNELGSFSVV
TKGIIFHNTLASSDYGYLKPEVFDPRPNYFAVLLWNRLMGTTVYDAAEPIREGAHVYAHS
RADGKPGKAYLVINNSLTETTTVTLPKEAEVYQLSAETLRSQTMLCNGKALVLGEGDALP
EIAPAAAPAGELVLPAATCTFIVL

Enzyme Prediction     

No EC number prediction in MGYG000000195_02758.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	74	504	1.2e-71	0.9428571428571428

CDD Domains     

MGYG000000195_02758 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN98036.1	1.25e-237	1	504	1	509
SNU86930.1	7.12e-215	1	504	1	507
SNV43376.1	8.61e-212	1	504	1	510
QTH47273.1	9.95e-211	1	504	1	510
AXI08463.1	3.26e-210	1	504	1	504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5LA4_A	4.40e-09	77	504	41	500	Crystalstructure of apo human proheparanase [Homo sapiens],5LA7_A Crystal structure of human proheparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens]
7RG8_A	7.71e-09	121	504	6	378	ChainA, Heparanase 50 kDa subunit [Homo sapiens]
5E8M_A	3.07e-07	143	504	18	380	Crystalstructure of human heparanase [Homo sapiens],5E97_A Glycoside Hydrolase ligand structure 1 [Homo sapiens],5E98_A Crystal structure of human heparanase in complex with HepMer M04S02a [Homo sapiens],5E9B_A Crystal structure of human heparanase in complex with HepMer M09S05a [Homo sapiens],5E9C_A Crystal structure of human heparanase in complex with heparin tetrasaccharide dp4 [Homo sapiens],5L9Y_A Crystal structure of human heparanase, in complex with glucuronic acid configured aziridine probe JJB355 [Homo sapiens],6ZDM_AAA Chain AAA, Heparanase [Homo sapiens]
5L9Z_A	7.17e-07	143	504	18	380	Crystalstructure of human heparanase nucleophile mutant (E343Q), in complex with unreacted glucuronic acid configured aziridine probe JJB355 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FF10	1.58e-16	75	465	75	455	Heparanase-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At5g07830 PE=2 SV=1
Q8L608	1.07e-13	75	465	72	451	Heparanase-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At5g61250 PE=2 SV=1
X4Y2L4	6.88e-13	75	482	40	458	Hyaluronoglucuronidase OS=Hirudo nipponia OX=42736 PE=1 SV=1
Q9LRC8	1.33e-12	75	484	73	491	Baicalin-beta-D-glucuronidase OS=Scutellaria baicalensis OX=65409 GN=SGUS PE=1 SV=1
Q9Y251	2.53e-08	77	504	75	534	Heparanase OS=Homo sapiens OX=9606 GN=HPSE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000195_02758.