CAZyme Information: MGYG000000195_00573

Basic Information

• Species: Faecalibacterium prausnitzii_E
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_E
• CAZyme ID: MGYG000000195_00573
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		33736.02	5.4176

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000195	3389403	Isolate	China	Asia

• Gene Location: Start: 82688; End: 83635 Strand: -

Full Sequence      

MLHLTVAQDGSGDYASVSEAVLAVPYELEAEIVIGPGVYREKLVCEKRCITLRGAGADQT
ILVWADGGKLPHPDGRPTHTFRSYTAFFSGESLTVEDLTIANDAGPGSLVGQAIAAYVDS
ARAVFRRVKLLGNQDTLFCAPLPEKEREKDGFLGPRTFAPRRASAQYYQNCEIAGDIDFI
FGGADALFEQCTLRTVNNHIPRSFVTAPSGPADGLGFVFWDCDLVSDCPAGTVYLGRPWR
PTGKTTVLDCRLGAHIAPDGFSPWNDRTDTGLASFAEKGSSGAGAAPRPAWVNEPSAADA
AALLARARKRCRPEV

Enzyme Prediction     

No EC number prediction in MGYG000000195_00573.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	302	4.2e-74	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.64e-54	6	285	87	379	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.96e-50	3	285	1	266	Pectinesterase.
PLN02773	PLN02773	1.31e-45	4	294	7	281	pectinesterase
PLN02745	PLN02745	3.90e-40	3	291	286	559	Putative pectinesterase/pectinesterase inhibitor
PLN02682	PLN02682	7.15e-39	4	294	71	346	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA44050.1	2.36e-199	1	313	1	313
ATP00222.1	2.36e-199	1	313	1	313
AXA81880.1	8.55e-189	1	314	1	314
CBK98674.1	2.45e-188	1	314	1	314
AXB27671.1	2.10e-181	1	314	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	7.24e-27	6	291	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.04e-26	3	286	8	274	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	5.82e-22	13	251	43	279	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	9.15e-17	14	256	18	276	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	5.35e-14	4	284	11	265	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	6.61e-35	6	277	9	262	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
O49298	2.26e-30	4	285	251	508	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q9LUL8	1.63e-29	3	269	660	904	Putative pectinesterase/pectinesterase inhibitor 26 OS=Arabidopsis thaliana OX=3702 GN=PME26 PE=2 SV=1
Q43062	4.20e-29	6	265	211	454	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q9LYT5	6.05e-29	3	284	228	481	Probable pectinesterase/pectinesterase inhibitor 35 OS=Arabidopsis thaliana OX=3702 GN=PME35 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000195_00573.