CAZyme Information: MGYG000000192_03093

Basic Information

• Species: Holdemania filiformis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemania; Holdemania filiformis
• CAZyme ID: MGYG000000192_03093
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000000192_26|CGC1	55616.56	5.4637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000192	3744496	Isolate	China	Asia

• Gene Location: Start: 32741; End: 34186 Strand: +

Full Sequence      

MNETTSAFPSDFIWGGAFAANQMEGAWQADGKGVCLADINEYVESLPLDQKCNTEMTTVQ
IQEALEAKDRIYPKRWGTDFYHRYPEDLRLLGKNGLGLTGYRTSINWSRIYPHGDDDLPN
EAGLRFYDRVIKTILENGMQPMITLSHYEMPLDLALNYNGWSDKRTIDFFVRYGKTVLDR
YHDQVHRWILVNQINLIDHESFNHLGIPADRVRHLNEAKMQGVINEMIACSQITEYAHRR
YPDVQIGMMLCGGPAYPATCDPSDVLAAQQRNQMQYFYGDVLLRGTIPGYAWRYFHDQGF
HLEVKEEELESLKNTADFFSFSYYYTRICDQKSWKDGHGAYRNPRLPANPWGWSIDPIGL
RIALNAYYDRYQKPIYITENGIGLKDELSADGAIHDDDRREYYQLHIEQMKEALADGVDL
RGIYLWSPIDIISCSSCEISKRYGFVYVDQNDVGQGSRRRIPKDSYAWLKRVIASNGEKL
D

Enzyme Prediction     

No EC number prediction in MGYG000000192_03093.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	477	2.1e-126	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.90e-160	5	481	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	5.37e-157	6	481	2	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	2.20e-146	6	480	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	4.86e-137	7	481	5	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.08e-127	8	480	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASR47559.1	3.70e-240	1	481	1	479
AET58894.1	2.02e-237	1	481	1	479
CQR58969.1	4.07e-237	1	481	1	479
AGF55533.1	1.40e-235	1	481	1	479
ADL02654.1	4.32e-234	1	480	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.79e-138	1	480	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	3.34e-135	8	480	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3QOM_A	8.58e-126	7	481	10	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	3.30e-122	9	480	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	2.72e-121	2	480	1	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P11988	2.30e-144	7	480	3	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
Q48409	1.40e-141	8	480	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	1.88e-139	5	480	2	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P40740	2.78e-137	1	480	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	5.27e-136	6	481	2	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000192_03093.