CAZyme Information: MGYG000000163_01961

Basic Information

• Species: Enterococcus_C asini
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_C; Enterococcus_C asini
• CAZyme ID: MGYG000000163_01961
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229	MGYG000000163_7|CGC1	26977.38	4.8278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000163	2560364	Isolate	China	Asia

• Gene Location: Start: 16862; End: 17551 Strand: +

Full Sequence      

MNQTQQGQKLAQIRTYLDELMERSTPSQPVWNQEAVLENKPPQWSYIDGCMLMAVQKLYE
LTGEQAYFSFLENFIDFYINEEGEILGYDYEAMNSDSINEGKVLFFLYQHTNKEKYRKAL
DRLYQQVRHQPKTPAGSFWHKAIYPNQVWLDGLYMVQPFYTAYELAWNEGQQLPEIMLQF
ANVQKHMKDEKTGLLYHAFDESKKAFWANPETGCSASFWSRSLDGTPWP

Enzyme Prediction     

No EC number prediction in MGYG000000163_01961.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	39	222	1.2e-56	0.5331325301204819

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	9.38e-52	44	222	34	205	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.96e-39	21	223	2	194	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
pfam07944	Glyco_hydro_127	0.002	49	130	178	261	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYY09443.1	6.51e-85	10	223	1	214
QCT91350.1	6.51e-85	10	223	1	214
QGR82798.1	6.51e-85	10	223	1	214
QOG25867.1	6.51e-85	10	223	1	214
QEH68585.1	2.70e-81	13	223	4	214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.75e-54	44	223	23	202	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.44e-46	37	223	30	215	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.51e-45	37	223	20	205	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.89e-45	37	223	30	215	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000163_01961.