CAZyme Information: MGYG000000162_00358

Basic Information

• Species: Enterococcus_B durans
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B durans
• CAZyme ID: MGYG000000162_00358
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241		27593.52	9.791

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000162	3083618	Isolate	China	Asia

• Gene Location: Start: 47262; End: 47987 Strand: +

Full Sequence      

MQKFEFEIINLLSQIIRNDWGSALASGNGQFMTLKMTSEIRWRGTLLDDLDFSINGLLKG
YYGGFLSQTLVPQEGVLSYHKLIKQRVRWCQGGMQCFFRYTKSVFKSKMISPQLKSDIVA
FMISAFFSMLIFPSSLVSIIVMIILFFHYPLSTFFIFCGILLINGLIAFTVYYSTAYVLK
VDKTLDNKLSILKFAYGNLLYTWLLSPVAYIAFFRLVIGKNNWEKTSHDGSQSSKELGEV
K

Enzyme Prediction     

No EC number prediction in MGYG000000162_00358.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	3.45e-07	45	222	236	411	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06436	GlcNAc-1-P_transferase	3.05e-06	2	49	140	191	N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine. N-acetyl-glucosamine transferase is responsible for the synthesis of bacteria Poly-beta-1,6-N-acetyl-D-glucosamine (PGA). Poly-beta-1,6-N-acetyl-D-glucosamine is a homopolymer that serves as an adhesion for the maintenance of biofilm structural stability in diverse eubacteria. N-acetyl-glucosamine transferase is the product of gene pgaC. Genetic analysis indicated that all four genes of the pgaABCD locus were required for the PGA production, pgaC being a glycosyltransferase.
pfam13632	Glyco_trans_2_3	2.79e-05	41	147	89	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
PRK11204	PRK11204	8.55e-04	82	171	268	359	N-glycosyltransferase; Provisional
cd06435	CESA_NdvC_like	0.004	12	95	145	230	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV94770.1	2.23e-164	1	241	193	433
AKZ47445.1	3.66e-163	1	241	193	433
QCJ63063.1	3.66e-163	1	241	193	433
AKX86070.1	3.66e-163	1	241	193	433
QPQ27061.1	3.66e-163	1	241	193	433

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
125	147
154	176
196	218