CAZyme Information: MGYG000000155_00597

Basic Information

• Species: Weissella confusa
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella confusa
• CAZyme ID: MGYG000000155_00597
• CAZy Family: GT113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251		28057.2	7.4729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000155	2346100	Isolate	China	Asia

• Gene Location: Start: 162799; End: 163554 Strand: -

Full Sequence      

MRGARVVLLVGDSLILREKVACSQSELNALNSADVLVVPNNKMRDQFTNMGVTTPMLHQG
LYPIKPTHDMPPLTTFNRDKVFYTGNLAKGPFLKTIQQDALAVEVFGPNAAPEVIANQSI
RYHGALSHHDLAQKLTAETGFGLIWDGDSLPMLSQLGRYTQYNYPYKSSFYLSLGMPLIA
WRGSAVADVITQYRCGIVLNRIEELGTTVKVLTTQQVNRMVENARNFGEELRTGRHFMRV
LAHAELFETED

Enzyme Prediction     

No EC number prediction in MGYG000000155_00597.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	2	244	2.3e-66	0.7453416149068323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	5.16e-52	2	234	91	319	sugar transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIE79080.1	3.20e-168	1	251	99	349
QYU58626.1	9.52e-60	1	114	99	212
QYU58627.1	1.69e-37	176	251	1	76
ARU19430.1	8.56e-35	5	234	94	320
AOO74061.1	1.20e-34	5	234	94	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	1.53e-12	31	244	124	325	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
3QKW_A	7.16e-09	31	244	124	325	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	7.31e-09	31	244	132	333	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	5.41e-16	81	241	164	320	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	2.90e-13	31	244	122	329	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
A0A0M3KKZ0	8.30e-12	31	244	122	323	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2
B3XPQ7	3.60e-09	31	244	122	328	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	3.68e-09	31	244	127	333	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000155_00597.