CAZyme Information: MGYG000000152_00240

Basic Information

• Species: Lacrimispora sp902363835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora; Lacrimispora sp902363835
• CAZyme ID: MGYG000000152_00240
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		36259.68	5.5924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000152	6260407	Isolate	United Kingdom	Europe

• Gene Location: Start: 261744; End: 262709 Strand: +

Full Sequence      

MIHISKDGTGDFKSIGEALCSLPGDPVSEQILYIHKGFYEEQITVTVPHVTFVGEDGENT
ILSYGLYARMVMEDGMKRGTFRTYSCLIDTHDFTARNLTFENSAGKSDEVGQALALYADG
DRLVFENCRFLGNQDTLFTGPLPPKEIEPNGFIGPKQHAPRINGRHYYKNCYIEGDIDFI
FGSATAYFEGCTFFSKYTGKEISSYVTAASTPKGQEYGYVMANCRFESNCPANNAYLGRP
WREYGKTVLLNCYMDDHICKEGWHDWNKDKAHIHTFYGEYGSFGPGAVMEKRPDWIRRLA
EADLKRFTKEAVLSGQDGWQP

Enzyme Prediction     

No EC number prediction in MGYG000000152_00240.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	314	1.3e-92	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.10e-80	11	315	93	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.96e-70	4	308	4	290	Pectinesterase.
PLN02773	PLN02773	1.02e-63	1	307	6	290	pectinesterase
PLN02682	PLN02682	4.97e-57	2	319	71	366	pectinesterase family protein
PLN02432	PLN02432	7.65e-57	1	319	12	291	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	1.05e-226	1	321	1	321
ANU50094.1	1.40e-141	2	321	17	348
QQR01004.1	1.40e-141	2	321	17	348
QIX89293.1	8.07e-141	2	321	17	348
QRP39805.1	2.38e-140	2	321	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	3.51e-37	4	295	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	8.37e-37	5	321	12	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	1.96e-36	2	315	9	304	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	3.72e-32	4	313	35	358	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	1.14e-26	2	292	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	6.85e-55	1	313	6	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	4.79e-47	4	321	260	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8GX86	8.47e-47	2	321	256	555	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
Q9FM79	3.41e-45	1	319	81	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9FJ21	4.95e-45	2	315	260	555	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000152_00240.