CAZyme Information: MGYG000000150_01441

Basic Information

• Species: Hungatella sp005845265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Hungatella; Hungatella sp005845265
• CAZyme ID: MGYG000000150_01441
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		50234.62	5.2559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000150	7470188	Isolate	United Kingdom	Europe

• Gene Location: Start: 98354; End: 99682 Strand: -

Full Sequence      

MTDLAMEKNMSGTIRLYDIDMEAAGHNERIGNDLSTREDASGKWNYETYSSLESALTGAD
FVVISILPGTFDEMAVDVHTPERLGIWQSVGDTAGPGGIMRSLRTLPMFVEIGEAIKKYS
PDAWVINYTNPMTLCVKVLYCVFPEIKAFGCCHEVFGTQRVLKGITEQMLGLKDIERSDI
HVNVLGINHFTWFDYASYRGIDLFPVYRDYIDSHFEEGFQEKDRSWMNSAFHCAHRVKFD
LFKKYGMIAAAGDRHLAEFMPGDLYLKDPETVKSWKFGLTTVDWRKNDLKERLEKSRKLF
EREEQVELKPTGEEGILLIKALCGLGRMVSNVNIPNTDGQISNLPVDEVVETNAIFDRNS
IRPIMAGSLPQPVLDLIMPHVRVHDKTMRAALSPDLELVVEAFLEDPNVKAKKPSEKDVR
SLVIDMLKGTKAYLPKEWEHWI

Enzyme Prediction     

No EC number prediction in MGYG000000150_01441.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	2	163	2.5e-46	0.88268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.10e-147	1	427	18	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.92e-94	1	440	21	441	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	3.32e-66	13	435	32	428	alpha-galactosidase; Provisional
cd05197	GH4_glycoside_hydrolases	3.90e-49	12	427	30	423	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
pfam02056	Glyco_hydro_4	6.16e-49	13	162	30	177	Family 4 glycosyl hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV18776.1	7.95e-238	1	439	28	466
QOV18468.1	2.27e-237	1	439	28	466
QRP41858.1	8.77e-235	1	439	28	466
ASN93484.1	8.77e-235	1	439	28	466
QJU22170.1	3.83e-234	1	436	28	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	1.09e-145	2	410	24	422	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	2.16e-23	55	436	77	436	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	1.10e-21	55	436	80	439	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1U8X_X	2.29e-21	14	436	60	463	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
6DUX_A	3.11e-18	53	211	75	226	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	2.34e-226	1	438	28	464	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	9.10e-183	1	434	28	458	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	8.32e-161	1	438	28	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	1.50e-149	1	427	27	440	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
P06720	3.95e-43	14	440	36	450	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999106	0.000837	0.000047	0.000006	0.000004	0.000017

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000150_01441.