CAZyme Information: MGYG000000144_01545

Basic Information

• Species: Barnesiella intestinihominis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Barnesiellaceae; Barnesiella; Barnesiella intestinihominis
• CAZyme ID: MGYG000000144_01545
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857	MGYG000000144_2|CGC9	96950.24	4.9978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000144	3314966	Isolate	United Kingdom	Europe

• Gene Location: Start: 850482; End: 853055 Strand: -

Full Sequence      

MIDCRKSLMVCIGLLMCGTFSAQESEFDLASQRSEAQDVFAVPGKKLDHKGIIINPTPHK
LVLDPTGRLDISGGVCLKDKHGKFSEDLDFVTFNKKGVKLSVDFGSKASAKYGVKPVSGA
YRMNIGKNGISIVGYDERGAFYGLQTLRQLVESPATVTGELPYVEIDDYPDLKYRGVVEG
FYGTPWSHEVRMSLIDFYGKFKMNSYLYGPKDDPYHSCPNWRLPYPEKEAGNIKELIEAC
KRNRVDFVWAIHPGQDIKWNEEDYQNLVNKFNLMYDLGVRAFALFFDDISGEGTNPVRQT
ELLNRLTKDFVKSKGDVAYLTVCPTDYSKLWANPTPQGSLAIYGETLDPSIEVFWTGDVV
CSDLTPETLDWVNSRIKRPAYFWWNYPVTDYVRNIILQGPVYGLNTSLDSNDLCGIASNP
MEHGEASKLALYGVADYTWNIAAYNPIDNWERGLGELMPKAREAYRTFAIHSCDTETGYR
RDESWETKTFRIGDWNETEAQALWAEFDKVEKAPAEIEKGCTNKGLMSELTPWLQEFGKL
GTRGKRSLELARVYRDGKDDADFWNKYIRNLMSKKDREDYEAHKSGTMKLQPFYENAMDD
MAYGFLTRLSGETPICYRGIGSFHNAKTTLSKLMFDHDTTTYYTSGIAQKAGDWIGVDLG
SVKDVTEVSILQGRNSVDDVDYFDHAVVEYSIDGKAWTPLTEELNKQYIVRWNGEPVKAR
YVRLKRLESTRTNYASVRSFEVNPPRVEHLGFSLKSDDVQQALYAFDQQIGTSYRNNGTF
SFGVAPRTEGYTLLVNELPEAGNGAPVVHLRQFRPDGSLAVESVIDSSFFKVELAEGVSE
VQIEGPVEIFEIVPKFD

Enzyme Prediction     

No EC number prediction in MGYG000000144_01545.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	175	469	4.3e-105	0.9932203389830508
CBM32	629	738	1.5e-16	0.8306451612903226

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	4.86e-165	175	468	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	3.41e-13	56	168	6	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	7.49e-11	635	725	18	111	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	2.04e-07	654	742	47	141	Substituted updates: Jan 31, 2002
COG3525	Chb	5.41e-07	118	229	205	316	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI62100.1	0.0	1	856	3	855
AHF11939.1	0.0	1	854	1	853
ALB75783.1	0.0	2	853	7	850
ADV43394.1	0.0	18	853	18	847
BBL05673.1	0.0	13	855	12	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MI4_A	5.19e-155	94	567	62	539	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	7.19e-155	94	567	50	527	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	7.41e-155	94	567	51	528	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
2CHO_A	7.41e-155	94	567	51	528	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	7.41e-155	94	567	51	528	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	7.59e-154	94	567	72	549	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.86e-87	130	550	142	571	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	4.86e-87	130	550	142	571	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	8.49e-51	130	743	143	795	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q8VIJ5	5.03e-35	176	439	63	331	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001082	0.692258	0.305407	0.000586	0.000371	0.000279

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000144_01545.