CAZyme Information: MGYG000000138_02474

Basic Information

• Species: Parabacteroides johnsonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides johnsonii
• CAZyme ID: MGYG000000138_02474
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		35102.12	10.0732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000138	4917599	Isolate	United Kingdom	Europe

• Gene Location: Start: 46888; End: 47799 Strand: -

Full Sequence      

MRLTLRILSFLLILSFTAPVFGASQRKVPAYEKYIRQYGNLAVQHQKKFRIPASITLAQG
LLESGAGQSELARKSNNHFGIKCHSDWRGGRVYHDDDLRGECFRKYKNPEQSYEDHARFL
ADRPRYAPLFKLRVTDYKGWARGLQKCGYATDRAYANRLIKIIEDYELYRYDTAKGNKGN
SGNKKPSAVVSRYTVYRTNDLLYVYSNGKDSFDDIAASLGFRVKDLKKYNEVPEDFPLQK
GDIVYLEKKKKKADKPNYDHVVQVGESMHSIAQKYGIQIKSLYKMNKKYKDYIPEEGDVL
KLR

Enzyme Prediction     

No EC number prediction in MGYG000000138_02474.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	40	168	8.2e-37	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.99e-41	3	184	8	200	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	4.50e-40	6	172	133	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	5.68e-27	39	168	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	3.97e-26	30	172	7	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK06347	PRK06347	1.39e-25	53	293	172	441	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT51213.1	8.65e-198	1	303	1	300
QUT94154.1	5.23e-165	1	303	1	302
BBK92151.1	6.08e-164	1	303	1	302
AST54914.1	6.08e-164	1	303	1	302
QUR47394.1	6.08e-164	1	303	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	7.92e-16	42	168	12	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	9.65e-16	42	168	13	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	6.67e-15	42	168	13	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
3FI7_A	8.40e-11	19	172	8	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	9.22e-11	51	220	80	273	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	4.52e-17	47	200	64	229	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	4.13e-16	27	167	156	306	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P37710	3.51e-15	53	286	202	457	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9KQ15	9.37e-12	51	170	181	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q2G222	1.35e-09	51	220	340	533	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000277	0.999089	0.000179	0.000152	0.000151	0.000141

TMHMM  Annotations     

start	end
7	24