CAZyme Information: MGYG000000137_00008

Basic Information

• Species: UBA7160 sp902363665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA7160; UBA7160 sp902363665
• CAZyme ID: MGYG000000137_00008
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	MGYG000000137_1|CGC1	51931.06	4.8747

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000137	4141348	Isolate	United Kingdom	Europe

• Gene Location: Start: 9713; End: 11134 Strand: -

Full Sequence      

MTNQEFIDQIAVYVKKYAAIFGICVHSPIIAQAILESGWGKSKLAATYHNYFGLKCGTKW
TGKSVNMNTQEEYEPGTLTTIADNFRVFDSMEEGVKGYFEFIQLSRYQNLKGITDPKTYL
ETIKADGYATSSTYVQNNMNLVEQYELTKYDSGKSDNMSDRQKPGNWLAQYEGIAEGSEQ
HKAILKVFNDSGLCTRYKMTVNDAWCATSVSAAFIAVGLSSIFPCVECSCENMINLAISA
GIWVENDAYVPDVGDVILYDWDDNGVGDCTGWSDHVGIVVSCDGSTIRVIEGNKSNTVGY
RDIAVNGKHIRGFITPHYAAGGSTTPQPSGKKSVQEVAKEVYAGEWGNNPERKEALEKAG
YDYQEVQDAVNELVNGSTPTPSKSVQDVAKEVINGQWGNNPDRQKKLEAAGYNYQEVQNA
VNAILKGNAATDLTAIAKEVILGKWGNGQERIDRLKAAGYSPTAVQKRVNELV

Enzyme Prediction     

No EC number prediction in MGYG000000137_00008.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	26	147	3.7e-31	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	8.33e-40	4	164	44	201	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	4.94e-23	1	151	158	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	1.05e-20	4	151	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.37e-19	13	98	3	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK05684	flgJ	2.09e-18	1	144	150	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFB75729.1	7.30e-147	1	378	1	378
QRT30096.1	2.79e-116	1	387	1	381
QEI31358.1	2.53e-114	1	387	1	381
QHB23853.1	2.53e-114	1	387	1	381
AFB75826.1	2.07e-70	1	151	1	151

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	6.73e-18	4	134	2	135	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	8.35e-18	4	134	3	136	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	5.39e-17	4	134	3	136	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN4_A	2.89e-10	1	158	1	166	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	3.99e-10	1	144	1	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9I4P4	1.34e-13	5	146	241	386	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
O32083	2.46e-11	3	151	48	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P0C2T5	1.51e-10	2	155	61	218	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	2.00e-10	2	155	61	218	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	8.33e-10	2	155	61	218	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995650	0.004327	0.000031	0.000008	0.000005	0.000008

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000137_00008.