CAZyme Information: MGYG000000136_02652

Basic Information

• Species: Agathobacter sp000434275
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter sp000434275
• CAZyme ID: MGYG000000136_02652
• CAZy Family: GH133
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247		27909.46	5.5237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000136	3864408	Isolate	Canada	North America

• Gene Location: Start: 32597; End: 33340 Strand: +

Full Sequence      

MDSDCLIHAGSGIDQVTWMDVRVGDWVVTPRHGKPVEINALWYNALQVMSELAQYFEEED
PYKDLAEQVARSFVAEFWNEKKQCLYDVVDNNLKDDSIRPNQIYAVSLPYTILPEGKAKA
VVTTVERELVAGPGLRSLSRDHKDYHPIYCGCLPKRDAAYHQGTAWGYLIGGFITAYTKV
HHHSKGSVAQARNYLKPIQEQFYDGCIGSISEIFDGDAPHHCRGCYAQAWSVGEVLRCYT
EDILPFS

Enzyme Prediction     

No EC number prediction in MGYG000000136_02652.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH133	3	237	1e-78	0.6424731182795699

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06202	GDE_C	2.46e-106	1	237	130	374	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	3.49e-60	1	244	385	608	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
TIGR01561	gde_arch	3.63e-58	1	177	394	574	glycogen debranching enzyme, archaeal type, putative. The seed for this model is composed of two uncharacterized archaeal proteins from Methanosarcina acetivorans and Sulfolobus solfataricus. Trusted cutoff is set so that essentially only archaeal members hit the model. The notable exceptions to archaeal membership are the Gram positive Clostridium perfringens which scores much better than some other archaea and the Cyanobacterium Nostoc sp. which scores just above the trusted cutoff. Noise cutoff is set to exclude the characterized eukaryotic glycogen debranching enzyme in S. cerevisiae. These cutoffs leave the prokaryotes Porphyromonas gingivalis and Deinococcus radiodurans below trusted but above noise. Multiple alignments including these last two species exhibit sequence divergence which may suggest a subtly different function for these prokaryotic proteins. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
TIGR01531	glyc_debranch	1.51e-13	6	239	1186	1462	glycogen debranching enzymye. glycogen debranching enzyme possesses two different catalytic activities; oligo-1,4-->1,4-glucantransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). Site directed mutagenesis studies in S. cerevisiae indicate that the transferase and glucosidase activities are independent and located in different regions of the polypeptide chain. Proteins in this model belong to the larger alpha-amylase family. The model covers eukaryotic proteins with a seed composed of human, nematode and yeast sequences. Yeast seed sequence is well characterized. The model is quite rigorous; either query sequence yields large bit score or it fails to hit the model altogether. There doesn't appear to be any middle ground. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam04685	DUF608	0.003	1	125	140	261	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV20708.1	8.02e-103	1	246	452	745
QSW20057.1	4.11e-99	1	244	411	656
QAA34021.1	1.78e-98	1	246	425	671
QVK17078.1	4.24e-98	1	244	408	649
AWB43120.1	1.04e-96	1	245	425	668

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000136_02652.