CAZyme Information: MGYG000000127_05196

Basic Information

• Species: Catenibacillus sp902363555
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp902363555
• CAZyme ID: MGYG000000127_05196
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	MGYG000000127_13|CGC2	93931.84	6.1593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000127	6637359	Isolate	Canada	North America

• Gene Location: Start: 87180; End: 89747 Strand: -

Full Sequence      

MTIDKILEKMTLKDKIALCSGANFWKTKAMEAYGIPSIFMCDGPHGLRKQENKGDMLGIH
ESQPATCFPTSVTVGMSWDSALSERIGRAIGAEAAACGVDLVLGPGANIKRDPRCGRNFE
YISEDPYVSGKMAAGFIRGLQENKTSASLKHFACNQQEYSRFTSDSVLDERTLREIYLSG
FEIAVREGRPHTVMCAYPKINGVHCSDDPRLLTGILRNEWGFDGLVVTDWGAMNDRIEGF
RSGCDLNMPGGSAYMEAEVLEAVRSGKLPESAVDASARRVLELVFRTAGRKAESSGGETH
PSTGEENPQSFDGKRHPSFDREKRPSFDGERRPSFDQNRHHLLAREAAEQGAVLLKNEDS
ILPLEKSQKIALIGFMAKHPRYQGTGSSHINPYRVTSAVEAMPECVWAPGCDALGNTDDT
LLAEAIAAAQNAEAAVVFAGLPDRYESEGFDRENLSMPEGHIRMIEAVAEANPNTVVVLL
CGCVVECPWADRVKAILYMGLPGQAGGEAAARLLYGEANPCGKLTESWPFTYSDCPSSGC
YGTKDAQYREGIYVGYRYYDKAGVKVRWPFGYGLSYTSFDYVDMRLDGNRVTVTVANTGR
LAGAEVVQLYIQPPAAEVVRLNAPPPIAEVVRLNTQPPAAEVAQLYVQPPAAGLHRPVKE
LKGFQKVFLQPGEEKTVEFLLDDRSFAVWQDGWKIPGGNYTIWAGSSSQDLFGCVHIQKD
GGTIPAPAWQEGSWYAHPSGTPDRETWEMMLGRPYVEAVPIRGQFTMDNSVMEMKEHSLI
MKIMYKVTEMIIARGFDGKKDYSNPQFRMMMEASVGGPLRGMQISGGIKGGVFCGLLHMA
NGHFFKGLWAMLSKK

Enzyme Prediction     

No EC number prediction in MGYG000000127_05196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	30	249	1.5e-69	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.29e-76	34	394	59	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	8.15e-68	3	689	38	733	beta-glucosidase BglX.
PLN03080	PLN03080	8.71e-58	65	712	111	776	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	6.50e-50	352	556	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.42e-45	34	283	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX00396.1	7.96e-307	10	854	1	747
AGC67350.1	1.30e-305	10	853	1	746
ANW97844.1	1.30e-305	10	853	1	746
AGI38411.1	1.30e-305	10	853	1	746
QFZ20634.1	1.42e-219	9	855	12	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	5.73e-206	3	711	5	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.64e-156	10	741	12	688	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.49e-107	3	711	4	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	6.53e-106	3	711	4	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	6.72e-97	3	711	6	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	3.14e-205	3	711	5	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	7.61e-156	7	740	9	696	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	2.99e-155	7	740	9	696	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q2U8Y5	8.21e-114	1	702	4	814	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
B8NDE2	1.15e-113	1	702	4	814	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000127_05196.