CAZyme Information: MGYG000000110_02626

Basic Information

• Species: Kluyvera sp902363335
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera sp902363335
• CAZyme ID: MGYG000000110_02626
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1030	MGYG000000110_4|CGC4	117853.73	5.0021

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000110	4775474	Isolate	Canada	North America

• Gene Location: Start: 242733; End: 245825 Strand: -

Full Sequence      

MNRWENLQLTHENRLPPRAYFFSYDSQAQARTFARETSSRFLSLSGQWNFRFFTNPLLVP
EAFTSQYLSDWEPITVPGMWQMEGHGQLQYTDEGFPFPIDVPYVPTDNPTGAYQRIFTLS
DGWQDQQTIIKFDGVETYFEVYVNGQYIGFSKGSRLTAEFDISDAVNTGDNLLCVRVMQW
ADSTYIEDQDMWWSAGIFRDVYLVGKNPLHVQDFTLRTDFNDDYIDATLSCQLVLENLAA
QAGEVTLEYALFDGEKALYEGATQRLTVNQQLNVDFAIDVKAPQQWSAENPYLYHLVMTL
KNAAGEIIEVIPQRVGFRDIKVRDGLFYINNRYVMLHGVNRHDNDHLKGRAVGMDRVEKD
LLLMKQHNINSVRTAHYPNDPRFYEMCDIYGLFVMAETDVESHGFANVGNLSAITDDPSW
EHVYVERIVRHVHAQKNHPSIIIWSLGNESGYGCNIRAMYHATKALDDTRLVHYEEDRDA
EVVDIISTMYTRVPLMNEFGEHPHEKPRIICEYAHAMGNGPGGLGEYQNVFYQHDSIQGH
YVWEWCDHGIQATDDNGAVWYKFGGDYGDYPNNYNFCLDGLIFSDQTPGPGLREYKQVIA
PVKVQAIDITRGELRVDNKLWFSTLDDYTLRVEVRAEGATLATQQLKVAGLAANSSRDIK
IDLPALDDRETFVNIMVTKDSRTLYSEANHPIAVYQFQLKEQTAAKTPLVNASAIPLHIA
DERLSYSITGHNFRVVFSKVSGKLSEWQVNGIDQVTREPKINFFKPMIDNHKQEYEGLWQ
PNHLQIMQEHLREFSAEQRGDTVIITTRSIIAPPVFDFGMRCTYRWQVTPQGHINVELEG
ERYGDYPHIVPCIGFMLGINGQFEQVNYYGRGPGENYADSQQSNIIDVWRTTVDDMFVNY
PFPQNNGNRQHVRWASFTDRHGSGLMVVPRSPLNVSAWHYKAENLHAAQHCNELHRSDDI
TLNIDAQLLGLGSNSWGSEVLDSWRVWLKPFNYGFTLLPLEGGCASSQRLANHSFDAGFF
SSDSHSEAEK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	28	886	2.9e-210	0.9773936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	0.0	36	887	7	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	0.0	4	984	17	1003	beta-galactosidase.
PRK10340	ebgA	0.0	1	1021	1	1021	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	5.05e-144	320	604	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	1.05e-104	729	997	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLO35005.1	0.0	1	1030	1	1030
QLT74518.1	0.0	1	1030	1	1030
QBG06358.1	0.0	1	1030	1	1030
QPF27080.1	0.0	1	1030	1	1030
QZY80715.1	0.0	1	1030	1	1030

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	5.39e-202	4	997	4	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	5.54e-202	4	997	5	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3OB8_A	1.58e-184	6	997	18	1029	Structureof the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
1JZ7_A	4.04e-182	4	993	16	1016	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]
1PX3_A	7.99e-182	4	993	16	1016	ChainA, beta-galactosidase [Escherichia coli],1PX3_B Chain B, beta-galactosidase [Escherichia coli],1PX3_C Chain C, beta-galactosidase [Escherichia coli],1PX3_D Chain D, beta-galactosidase [Escherichia coli],1PX4_A Chain A, beta-galactosidase [Escherichia coli],1PX4_B Chain B, beta-galactosidase [Escherichia coli],1PX4_C Chain C, beta-galactosidase [Escherichia coli],1PX4_D Chain D, beta-galactosidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P06864	0.0	1	1027	1	1027	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q56307	3.04e-201	4	997	5	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	1.50e-197	6	1000	23	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
P00723	7.14e-184	6	997	11	1022	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2
A6T8X0	5.17e-183	4	997	23	1032	Beta-galactosidase 1 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=lacZ1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000110_02626.