CAZyme Information: MGYG000000107_03567

Basic Information

• Species: Klebsiella_A oxytoca
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A oxytoca
• CAZyme ID: MGYG000000107_03567
• CAZy Family: CBM41
• CAZyme Description: Pullulanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1090	MGYG000000107_6|CGC1	118213.41	4.5157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000107	5859765	Isolate	Canada	North America

• Gene Location: Start: 65745; End: 69017 Strand: -

Full Sequence      

MLRYTRNALVLGSLVLLSGCDNGSSSSSSGNPDTPGNQDVVVRLPDVAVPGEAATAAENQ
AVIHLVDIAGITSNSAADYSSKNLYLWNNETCDALSAPVADWNDVSTTPSGSDKYGPYWV
IPLNKESGCINVIVRDGTNKLIDSDLRVAFGDFTDRTVSVIAGNSAVYDSRADAFRAAFG
VALAEAHWVDKNTLLWPGGQDKPIVRLYYSHSSKVAADGEGKFTDRYLKLTPTTVNQQVS
MRFPHLSSYAAFKLPDNANVDELLQGETVAIAAAEDGILISATQVQTAGVLDDTYAEAAE
ALSYGAQLTDGGVTFRVWAPTAQQVDVVVYSADKKVIGSHPMTRDSASGAWSWQGGSDLK
GAFYRYAMTVYHPQSRKVEQYEVTDPYAHSLSTNSEYSQVVDLNDSALKPDGWDSLTMPH
AQKTKADLAKMTIHESHIRDLSAWDQTVPAELRGKYLALTAGDSNMVQHLKKLSASGVTH
IELLPVFDLATVNEFSDKVADIQQPFSRLCEVNSAVKSSEFAGYCDSGSTVEEVLNQLRQ
SDSQDNPQVQALNTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTTRIKEFRTMIQAIKQ
DLGMNVIMDVVYNHTNAAGPTDRTSVLDKIVPWYYQRLNETTGSVESATCCSDSAPEHRM
FARLIADSLAVWTKDYKIDGFRFDLMGYHPKAQILSAWERIKALNPDIYFFGEGWDSNQS
DRFEIASQINLKGTGIGTFSDRLRDSVRGGGPFDSGDALRQNQGVGSGAGVLPNELTSLN
DDQVRHLADLTRLGMAGNLADFVMIDKDGAVKKGSEIDYNGAPGGYAADPTEVVNYVSKH
DNQTLWDMISYKASQEADLATRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYD
SGDWFNRVDYSLQDNNYNVGMPRISDDGSNYDVISRVKDMVAAPGEAELKQMTAFYQELT
ELRKSSPLFTLGEGSAVMKRVDFRNTGSDQQAGLLIMTVDDGVKAGASLDSRLDGLVVAI
NAAPESRKLNEFAGETLQLSAIQQAAGENSLAHGVQIAADGTVTLPAWSVAVLEMPQGDA
QGAGLPVSSK

Enzyme Prediction     

No EC number prediction in MGYG000000107_03567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	469	888	7.9e-144	0.997229916897507
CBM41	75	171	2.2e-18	0.8921568627450981

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02103	pullul_strch	0.0	180	1077	1	898	alpha-1,6-glucosidases, pullulanase-type. Members of this protein family include secreted (or membrane-anchored) pullulanases of Gram-negative bacteria and pullulanase-type starch debranching enzymes of plants. Both enzymes hydrolyze alpha-1,6 glycosidic linkages. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family is closely homologous to, but architecturally different from, the Gram-positive pullulanases of Gram-positive bacteria (TIGR02102). [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PLN02877	PLN02877	0.0	162	1072	71	965	alpha-amylase/limit dextrinase
cd11341	AmyAc_Pullulanase_LD-like	6.65e-167	431	919	3	395	Alpha amylase catalytic domain found in Pullulanase (also called dextrinase; alpha-dextrin endo-1,6-alpha glucosidase), limit dextrinase, and related proteins. Pullulanase is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. Pullulanases are very similar to limit dextrinases, although they differ in their action on glycogen and the rate of hydrolysis of limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
TIGR02104	pulA_typeI	2.41e-125	305	1030	13	585	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.
COG1523	PulA	4.03e-89	312	1073	68	689	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEF71056.1	0.0	1	1090	1	1090
AYZ53910.1	0.0	1	1090	1	1090
AWF37522.1	0.0	1	1090	1	1090
QSS39442.1	0.0	1	1090	1	1090
APB47231.1	0.0	1	1090	1	1090

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YN2_A	0.0	1	1090	1	1102	ChainA, PulA protein [Klebsiella pneumoniae],5YN7_A Chain A, PulA protein [Klebsiella pneumoniae],5YNA_A Chain A, PulA protein [Klebsiella pneumoniae],5YNC_A Chain A, PulA protein [Klebsiella pneumoniae],5YND_A Chain A, DUF3372 domain-containing protein [Klebsiella pneumoniae],5YNE_A Chain A, PulA protein [Klebsiella pneumoniae],5YNH_A Chain A, PulA protein [Klebsiella pneumoniae]
2YOC_A	0.0	21	1089	2	1070	ChainA, Pullulanase [Klebsiella oxytoca],2YOC_B Chain B, Pullulanase [Klebsiella oxytoca]
6J35_A	0.0	39	1090	2	1053	ChainA, Pullulanase [Klebsiella pneumoniae],6J35_B Chain B, Pullulanase [Klebsiella pneumoniae],6J4H_A Chain A, Pullulanase [Klebsiella pneumoniae]
6J33_A	0.0	39	1090	2	1053	ChainA, pullulanase [Klebsiella pneumoniae],6J33_B Chain B, pullulanase [Klebsiella pneumoniae],6J34_A Chain A, Pullulanase [Klebsiella pneumoniae]
2FGZ_A	0.0	38	1090	31	1083	ChainA, Alpha-dextrin endo-1,6-alpha-glucosidase [Klebsiella pneumoniae],2FH6_A Chain A, Alpha-dextrin endo-1,6-alpha-glucosidase [Klebsiella pneumoniae],2FH8_A Chain A, Alpha-dextrin endo-1,6-alpha-glucosidase [Klebsiella pneumoniae],2FHB_A Chain A, Alpha-dextrin endo-1,6-alpha-glucosidase [Klebsiella pneumoniae],2FHC_A Chain A, Alpha-dextrin endo-1,6-alpha-glucosidase [Klebsiella pneumoniae],2FHF_A Chain A, Alpha-dextrin endo-1,6-alpha-glucosidase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07811	0.0	1	1077	1	1087	Pullulanase OS=Klebsiella aerogenes OX=548 GN=pulA PE=1 SV=1
P07206	0.0	1	1090	1	1090	Pullulanase OS=Klebsiella pneumoniae OX=573 GN=pulA PE=1 SV=2
Q8GTR4	5.80e-169	184	1072	88	958	Pullulanase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PU1 PE=1 SV=2
O33840	3.52e-57	79	910	34	725	Pullulanase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=pulA PE=1 SV=2
C0SPA0	9.93e-54	285	914	91	597	Pullulanase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000047	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000107_03567.