CAZyme Information: MGYG000000106_01260

Basic Information

• Species: Enterococcus_D gallinarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D gallinarum
• CAZyme ID: MGYG000000106_01260
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208	MGYG000000106_3|CGC5	24427.5	4.2275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000106	3151412	Isolate	Canada	North America

• Gene Location: Start: 304834; End: 305460 Strand: -

Full Sequence      

MIPKIIHYCWFGGNELGESEQKYIETWRKFCPDYEIKRWDESTIDLSKFGSYLQEAYKQE
EWAFVSDVVRLYALVTEGGIYMDTDVEVVKPLDDLLNYEAFMGFEIETKISTGIIGAVPH
HPFMEEWYHDYDDREFVRAEKTEDVVTNVIRVTELLQEYGLQLNNQRQTVKGVEIFPQMT
FSPKSYITGEVEEDPTTMVIHQFSGSWL

Enzyme Prediction     

No EC number prediction in MGYG000000106_01260.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	97	2.8e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.25e-25	1	123	81	206	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	6.43e-17	17	101	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.35e-08	1	131	45	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	8.32e-04	14	85	117	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT91872.1	2.17e-158	1	208	1	208
QGR83401.1	2.17e-158	1	208	1	208
QOG26496.1	2.17e-158	1	208	1	208
AYY09972.1	1.26e-157	1	208	1	208
ATF71246.1	4.89e-146	1	208	1	208

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	1.43e-11	2	124	57	181	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
P38287	1.75e-10	1	124	61	186	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q9UT67	2.51e-09	1	188	81	274	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
Q9UNA3	2.82e-08	45	159	127	241	Alpha-1,4-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=A4GNT PE=1 SV=1
P33300	3.04e-08	1	124	54	179	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000106_01260.