CAZyme Information: MGYG000000104_01193

Basic Information

• Species: Clostridium cuniculi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium cuniculi
• CAZyme ID: MGYG000000104_01193
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
924		106635.92	4.7652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000104	3679160	Isolate	Canada	North America

• Gene Location: Start: 95717; End: 98491 Strand: -

Full Sequence      

MTKINLHGEWNFQLDKDKTGINNELFKKELNDTIILPTTTSEAKKGKINTAREVGFLTDL
YKFEGFAWFSKDVEFTENYSDSYIELVMERTRVTHLWIDDKYVGTYNSLCTSHHYDITSY
ISKNKHKITIMVDNTSYPTKGGHMTSPDTQTNWNGITGEISINITNKTRLSNVKFYPNIE
DKTVTVKGNILGDKIDKISLIAFDYNKTFEKQTYNINNDFFEVKYFMSDDVEFWSEYNPH
TYKMEIGIEKDKQILNEDIYSFGMVSFKTNEKKFLINGKETFLRGKHDGLIFPLTGYAPT
DIESWIKVLKTAKEYGINHYRFHTCCPPKAAFEAADMLGIYMEPELPFWGTITTEDDENH
DAAMQAYLIEEGYRMLDEFGNHPSFVMMSLGNELWGSKETLNSILKGYKEYDNRHLYVQG
CNNFQWAPCILEEDDFFSGVRFSGDRLYRGSYAMCDAPQGHIQTDAPNTNHNYDEIIRPS
ASEKGSSGEVGVKQIQYGTGVKEVIVSEVEEFIPNVPVISHEIGQYETFPNFKEIDKYTG
VLRARNFEVFKERLEEKGLIDKADMYFKASGKLAADCYKGELETAFRSNELAGFQLLDLQ
DFSGQGTALVGILDAFMDNKGIISSEEWREFCSDCVLLGEFSKYVWSSKEEFKCNIKLTN
YKKEMKADIIIRVELLSNTEVVWNKEIQINKLHIGVNSLASLSFELPDCKIPQKYILKLS
STTLSISNHYDLWVYPIVPEIDNKDILITNNLDELLNGISNNKNILYYPGEDEILNSIEG
TYCTDFWCYPMFRSISESMGKPIPVGTMGLLINEKHPALENFPCEFYSTPQWWEIVMNSR
LSILDDVKIDPIVQMIDNFERNHLLGLIYEFKVNESNILVCTSPLEDIKDSIEAQWLRYS
LIKYMRSDNFKPEKIIDMKMINKN

Enzyme Prediction     

No EC number prediction in MGYG000000104_01193.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	453	3e-59	0.4853723404255319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.72e-24	1	492	10	520	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.77e-13	5	393	14	417	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.62e-07	229	393	281	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	1.38e-06	6	136	4	137	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02836	Glyco_hydro_2_C	3.80e-06	267	413	1	154	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH20142.1	0.0	1	918	1	919
AXB87241.1	0.0	1	918	1	919
QGH24177.1	0.0	1	918	1	919
QJU46745.1	0.0	1	918	1	919
QCJ08504.1	0.0	1	918	1	919

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U7J_A	1.28e-11	6	411	24	435	UnculturedClostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_B Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_C Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_D Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.]
6S6Z_A	3.11e-11	4	416	39	462	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.11e-11	4	416	40	463	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3GM8_A	3.58e-11	4	420	7	424	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6ETZ_A	3.65e-06	231	420	260	447	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	2.51e-12	2	395	52	432	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q56307	1.70e-10	4	416	40	463	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q03WL0	3.79e-10	95	393	147	456	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1
Q04F24	3.79e-10	95	393	147	457	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1
B4S2K9	4.40e-09	95	412	151	478	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999960	0.000071	0.000007	0.000000	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000104_01193.