CAZyme Information: MGYG000000102_03391

Basic Information

• Species: Terrisporobacter sp902363255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Terrisporobacter; Terrisporobacter sp902363255
• CAZyme ID: MGYG000000102_03391
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1109		131044.1	8.4158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000102	3838773	Isolate	Canada	North America

• Gene Location: Start: 54135; End: 57464 Strand: -

Full Sequence      

MLDKVKSVLYSKKCKKDCKTKYLEIYKDCKIDNNKILLEPGQGKNLNGNMFAFVREIMTN
NKWKHLNVDFVVTKSTINDAKSRFELYGFNGVNFVIRNSDEYIKSLATSKYLITDNSFPI
YFIKKEEQIYLNTWHGTPLKYLGRSDLKNSTSIGNIQKNFLNANYILFPNEFTRDVFMND
YMLENIGTNKVLLCDYPRNEAFSNELMKKEIKKSMKLEDKELIAYMPTWRGSGRKANSKK
QIKTIIEYLHEIDKNLKENQILYVNLHFLVTSSMDFSEFNKIKPFPKEYETYDFLNCCDI
LITDYSSVFFDYAIKEKKVILFAYDEEEYLEEKGTYFPLSDLPFPKVKSIDSLIEEINCK
NHIDVKEFNNKYNNYIQDKVTEKILDLLVYDSETNLKIESPPRNNNKNILIHGGSLNNKI
INTKILELIEKINDKNKNIILSFEDGLNKNKCDFLQLLPENVNFISLVKSSCFNVFWNDV
EVNLFEENKEALELEKKNIFCNIDFDEIIQMALRRKKLAYVFAMYNSIKTVYFFPDMIEG
FQYNSPKTKDIKRFEKEQFDQIEEIKIEELLKDERVNLNKTNVYNRCINITNHKSLFYNS
KNKLNIIAICVIKAEVDLNKKKFVIKVQDKIYPLNILLKKGINIGKNRRVNLYHFSIPFE
DCINLELHNKISLSYEDQDGYGFEKLIKIKKGATINAPVKLLKNKDLAMYFRKTGGNSLY
ITVRNANITDNYLEKFKISFAWILSKFIKSINPILLFEKHAARYEESASVLYEKLIDMGY
DNVYFILDKNCSYLSEIDSKYKKSIINKYSLKHYLHMFCCNTFISSESIAHACEVRTTNR
LINNKLNDPKLNYVFLQHGVMYMVSLNSNSRKFFRKKNTEGLKRVVVSSEIEGKHFIDYA
NYNAEDIYICGLPKFDRNKWNKGANKIIIMPTWRPWEYNQARLNFTETKYYKMIIKILNS
IPSKYKENVIVLPHPLIAESMLEIDDDILKYMNFEDKYDDLLKDAKVLITDYSSISYDAF
YRGSNVIFYWEEKNYCMECYGDNTRLMLDEENCFGDICYNTEDLKKVFEKNYLEGQCEKY
IQNYQKIVQFNDNKNTERLIEFLKEDKII

Enzyme Prediction     

No EC number prediction in MGYG000000102_03391.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	9.33e-54	31	390	2	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	3.01e-37	31	388	24	384	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
pfam04464	Glyphos_transf	9.30e-13	752	1103	5	358	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	2.64e-09	924	1107	207	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK97012.1	1.15e-114	19	601	23	616
CBL33357.1	6.04e-112	19	562	23	578
BCJ93365.1	3.29e-104	21	547	390	922
QHQ61047.1	2.70e-100	4	554	373	924
ABX40684.1	5.98e-100	22	554	381	916

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.75e-27	95	397	404	723	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	1.23e-26	95	397	404	723	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	2.84e-26	95	397	404	723	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	1.49e-28	36	390	34	378	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	2.16e-26	95	391	404	717	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
P13485	2.16e-25	91	357	430	705	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1C1	4.57e-24	90	377	74	362	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P27621	4.92e-21	106	388	95	376	Teichoic acid glycerol-phosphate primase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000102_03391.