CAZyme Information: MGYG000000102_00334

Basic Information

• Species: Terrisporobacter sp902363255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Terrisporobacter; Terrisporobacter sp902363255
• CAZyme ID: MGYG000000102_00334
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000000102_1|CGC4	44897.81	4.632

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000102	3838773	Isolate	Canada	North America

• Gene Location: Start: 336718; End: 337884 Strand: +

Full Sequence      

MYIKGVNLGNWLVLEKWMSPGLFEGTTAEDEYYLPRQLSKEVYEARIRTHRSEYITERDF
ATIKSMGLNSVRIPVPYFIFGDCEPFIGCAEELDKAFSWAGKYGLSILIDLHTVPGSQNG
FDNGGISGVCKWSKQPESVEFTLSVLERLAKRYGKRNELWGIQILNEPITERMWNMMDVP
NRYKAVDEEMAKGSGPNTLEFLREFYIKAYKVMRPHMAKENVIVIHDGFELKAWKDFMRE
EEFENVVLDTHQYLMFAESEGCEQSVDGYVKYIQDNYAKDIADMQEYFPVICGEWSLFNS
YGCGIDTAGGQSPLNGIDSNVDKLSKNEKKELYRTIAKAQLDAWRNGAGHYYWNYKLLLD
TVNEDGWIGWDSWDLGKCVAQEWYPVEY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	49	356	2.5e-149	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.00e-28	2	379	17	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	2.39e-05	53	183	22	146	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXU62824.1	1.11e-264	1	388	1	388
AVB55458.1	2.25e-264	1	388	1	388
AYD12503.1	2.25e-264	1	388	1	388
QGS40347.1	2.25e-264	1	388	1	388
AVB59085.1	2.25e-264	1	388	1	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	5.10e-177	1	385	1	387	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	4.16e-176	1	385	1	387	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	1.05e-49	3	356	13	372	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	2.49e-45	3	367	9	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	6.79e-45	3	367	9	367	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8N151	2.06e-54	3	375	31	386	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	2.06e-54	3	375	31	386	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
Q0CR35	2.84e-53	3	375	40	396	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
Q5B5X8	2.47e-51	3	375	29	384	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q12700	1.49e-50	3	388	42	414	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000102_00334.