CAZyme Information: MGYG000000100_02249

Basic Information

• Species: CABIZH01 sp902363205
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Massilibacillaceae; CABIZH01; CABIZH01 sp902363205
• CAZyme ID: MGYG000000100_02249
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654	MGYG000000100_6|CGC1	75664.43	5.7579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000100	2685351	Isolate	Canada	North America

• Gene Location: Start: 255342; End: 257306 Strand: -

Full Sequence      

MRKIVELLHDEIVYLAGNWEDIEANEIVDRSLSVLISIKKRLASKEKIVANICNFLEKKY
QDLQLDHKTEYKQIVCQDYINPVLVYLKDYFDEKHLTLGELQLAINKAIEQKLFKQAEQY
LMCLRAAFGSDEKFFYITAYVFSQLEKYEEAVAEAEFAIKYKSCLDAEAYMIIGFAKRGL
FMYREAISALETSNLLVLKDSMIKESAFVGRNFLALGQLYMYVGEIKKACEAYLSASKYN
VVAKEKCEAYSSYLMCLHYEDVMTSENLFQEHCKYKNLLSSVPKETLYHMRKKKKIRIGY
ISPDFRQHVMSFFYRVFLQYYNKQSFEVYCYCLNEEDKITMQLKRFVNQWRNVKGLDNYS
VASLIAQDEVDILVDLAGHSANNALPILNYRPAPVQISGLGYFDTTGLKTVDYILTDNFV
DPIGIYDNLFSEKLLRLPYCQFCYTPWDDAPTIGLSPYIKNGYVTFGCFNKYAKITNQAI
EVWSQILKQVKGSKLILKSLVYIDENFCKEVFDRFAEFGIEARKLELRPATSDYMEQLRD
IDIALDTFPYPGGGTTCDTLYMGVPVITMEGQRHGARFGYSILCNVGLGELVAKNTQEYI
EKAVALANDLELIDILHKNLRTMMEKSPLMDTQLYMQEIERAYSEILANKWLNG

Enzyme Prediction     

No EC number prediction in MGYG000000100_02249.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	40	650	2e-107	0.6851063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3914	Spy	5.68e-92	291	646	255	614	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
pfam13844	Glyco_transf_41	6.74e-27	295	639	80	543	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL84162.1	1.41e-116	178	646	74	542
AEB99306.1	1.72e-115	216	654	50	484
BAL83943.1	2.08e-115	211	649	128	568
AEB99305.1	7.94e-115	216	647	120	553
AOH48972.1	1.43e-112	100	646	10	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	6.49e-57	294	643	161	512	Thermobaculumterrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]
2VSN_A	1.73e-29	260	617	170	530	Structureand topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
2JLB_A	7.42e-29	260	617	170	530	Xanthomonascampestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
6Q4M_A	5.99e-27	295	646	237	705	Crystalstructure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
6IBO_A	7.95e-27	295	646	237	705	Catalyticdeficiency of O-GlcNAc transferase leads to X-linked intellectual disability [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6YZI0	6.88e-81	241	643	408	828	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1
Q8LP10	1.16e-80	293	643	457	811	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum OX=52518 GN=SPY PE=2 SV=1
Q8RVB2	4.76e-78	254	643	443	842	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum OX=4081 GN=SPY PE=2 SV=1
Q96301	7.19e-78	293	643	480	837	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
O82422	7.83e-78	254	643	429	828	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare OX=4513 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000100_02249.