CAZyme Information: MGYG000000098_03938

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_03938
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647	MGYG000000098_47|CGC1	73015.56	6.9366

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 7573; End: 9516 Strand: -

Full Sequence      

MKAHLFILFFLLGINPVPYLFLPDLLAQSNIVKAVAGDLLIDGNPSSVKIGDYMGEKINA
CINKRVMGQDVHHLITPFYHKTETYRWQSEFLGKWLLGAVLSYRYTQNPVLLDSIQKGVT
GLIESQSSDGYIGNYSPDAQLQQWDIWGRKYSMLGLLAYYDLTGDKKVLSACKKAADHLM
TQVGPDKVDIVSTGNYYGMASCSVLEPIVFLYRRTGDVRYLEFAKYIVGQWETATGPKLI
SKAMEGIPVGDRFPHPSSMNETWFGTKNGQKAYEMMSCYEGLLEIYKLTNDSLYLNAVEK
TVRSIADTEINIAGSGSAFECWYHGKNLQTIPTYHTMETCVTMTWMKLCQTLLRLTGNPY
YADQMEITAYNSLLASMKSDASQIAKYSPLEGQRHPGEEQCGMHINCCNANGPRAFALLP
QFAFMQSSDRKAIFVNLYTDSNAEILLASNKKVRVVQETNYPQEGETCIKIDSDKPETFS
VALRIPSWSKKNAIKVNEQEMSDIVPGTYYKITRRWEKGDVITLNLDVRGRLIRQDNHVA
IVKGPVVLARDSRFGDGFVDQTAQVVVHEGNYVDLIPVEVKKDWNWMSYTVPLVLGTDLE
GEGKQPKQVHFCDFASAGNTWSGDIRYRVWIPETLNVMNRAYVPYNK

Enzyme Prediction     

No EC number prediction in MGYG000000098_03938.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	81	549	9.4e-63	0.898854961832061

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.99e-66	87	549	55	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.65e-57	73	633	49	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG4225	YesR	1.89e-04	144	325	34	182	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04791	LanC_SerThrkinase	0.002	154	225	93	169	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.85e-218	48	647	27	622
QJD88475.1	3.79e-39	88	639	68	650
CAZ97289.1	2.45e-38	87	552	119	606
QHS51661.1	2.89e-38	64	647	101	675
QOY86860.1	3.53e-37	92	547	95	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.87e-32	80	554	60	553	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	3.39e-26	88	550	75	554	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	9.23e-26	94	552	105	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	5.41e-23	88	550	75	554	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	6.65e-21	94	626	80	653	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.64e-20	94	626	80	653	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.292856	0.705327	0.000895	0.000289	0.000255	0.000366

TMHMM  Annotations     

start	end
5	27