CAZyme Information: MGYG000000095_01729

Basic Information

• Species: GCA-900066755 sp902363085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066755; GCA-900066755 sp902363085
• CAZyme ID: MGYG000000095_01729
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1092	MGYG000000095_4|CGC5	127947.48	5.7554

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000095	5524222	Isolate	United Kingdom	Europe

• Gene Location: Start: 279511; End: 282789 Strand: +

Full Sequence      

MRKTLFIKYNKTRRKKFQISTAICQDENGFVVEKRPLNQEAYKHINELQSNFEILEPVYT
KIKFLKPQINNNVASFNYVSGKTLEQELQVHLDDLESLIAEIKRKIDDIFQISSSYITDF
YVSEEYVNMFGTNYNYNGKAVTVANIDMLFDNIIEIKGDSYCLDYEWVFKFPVPIDFLVY
RCLTYFYNRYSYKIKKYCTREQFLNKFEIYTVDFFDSMETNFQKYVHGNNLEWIYTSNYI
KETETLDELTSYEEEALRSRSRIIQLQNEEEERNEHLHKLDEEIEVLRSEVKNCYNQLDI
AHKEQASSAIYTNELHQKIKSMEKEQKEQLKKIREIKEQEIEKRDNDIAFLNDLVHSKER
IIDDQTLLIQNKDRYICDLELYTQKIQNSLFYKIAKLPKKVLSKIFPRDSRRRKILGYCK
HALIHPINFINASSDSKNRILGDILIGRGYLEKGKAIFKYEENPLVSIIIPVYNQVTYTY
NCLHSIIENTRDVTYEVIIADDVSSDATKHLKKLTENITIIRNNRNLGFLKNCNNAAEKA
RGKYILFLNNDTQVNDNWLSSLKNLIESDPKIGMVGSKLVYPDGRLQEAGGIIWSDGSGW
NYGRMDDPNKPEYCYVKDVDYISGASIMIKKDLWQQIGGFDERYAPAYCEDSDLAFQVRD
LGYRVVFQPLSIVTHYEGISNGTDVSQGIKQYQVENSVKFRNKWKKELEGQPEGPDSLFY
ARDRSNHKKTILVIDHYVPMYDRDAGSRTTYQYIKMFLQKGFNVKFIGDNYYPMQPYTSQ
LEQLGVEVLYGTWYAQNIFEWIGNNKEFIDFAYVTRPHIVIKYIDFLRDQTNIKIMYYGC
DLAALRLRREYELTNQEEIREEAESWEEKEFYIMKKADVSYYPSYVEVDYIKGIDPSIHV
KPFNIFAYDEFKKDLTLNFKDRKGLMFVGGFAHGPNIDAAIWFVTQVYPLIREKEKIPFY
IVGSNPTDEVKALANDDVIVTGFVSDEELDRIYSNCKMAVVPLRYGAGVKGKVIEALYNG
MPLVTTSIGAEGIVGASKVMEIVDGEREFAQSILRLYHRNDLLEKMSVNTQDFVKKYFSM
DAVWESVGEDFR

Enzyme Prediction     

No EC number prediction in MGYG000000095_01729.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	467	707	1.3e-25	0.8542372881355932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	4.75e-49	468	677	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.13e-42	463	682	2	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	6.71e-24	467	633	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13692	Glyco_trans_1_4	1.55e-23	922	1058	1	137	Glycosyl transferases group 1.
COG1215	BcsA	5.18e-23	453	674	43	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL06321.1	0.0	1	1091	1	1037
QRV19580.1	0.0	1	1091	1	1037
SET96232.1	0.0	1	1091	1	1034
ASN93838.1	0.0	3	1092	265	1314
QRP41495.1	0.0	3	1092	265	1314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	1.06e-09	464	685	13	212	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
2D7I_A	7.02e-07	461	675	109	337	Crystalstructure of pp-GalNAc-T10 with UDP, GalNAc and Mn2+ [Homo sapiens],2D7R_A Crystal structure of pp-GalNAc-T10 complexed with GalNAc-Ser on lectin domain [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	8.26e-22	455	682	616	852	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.70e-14	464	684	574	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q48455	2.66e-12	892	1087	187	384	Uncharacterized 44.6 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
O32268	1.84e-09	464	584	6	130	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
P9WLV8	3.72e-09	464	605	17	148	Uncharacterized protein MT1568 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1568 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000095_01729.