CAZyme Information: MGYG000000082_01800

Basic Information

• Species: Acinetobacter mesopotamicus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter mesopotamicus
• CAZyme ID: MGYG000000082_01800
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
193		21390.41	10.5339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000082	3378595	Isolate	United Kingdom	Europe

• Gene Location: Start: 66995; End: 67576 Strand: +

Full Sequence      

MFFSHLLNPIKSKRSLFNSHSFKFSSILLSTFLFAGCSSLGGGSVEKRAAKLSKGIQTAY
STPSSTANRVSPLIVQHAQNQGVDPLLVAAVIHQESTYRSQATSPAGAVGLMQVIPRYWQ
QTCPGDLYNESSNIQCGTYILSKYNQSSGDWKKALAYYNVGPSGYENNRKMRKQGKRYAN
RVKQHKKMLKDSL

Enzyme Prediction     

No EC number prediction in MGYG000000082_01800.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	82	186	7.4e-25	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.99e-28	73	188	7	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.27e-25	85	185	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.33e-21	71	163	7	109	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	6.66e-19	64	183	133	262	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd13403	MLTF-like	3.06e-17	74	176	1	111	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPF33335.1	2.45e-134	1	193	1	193
AUC07736.1	2.45e-134	1	193	1	193
QZM10813.1	2.26e-130	1	193	1	193
QXX87016.1	6.48e-130	1	193	1	193
QXR08766.1	1.86e-129	1	193	1	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	6.52e-09	66	162	409	515	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.53e-09	66	162	413	519	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.55e-09	66	162	419	525	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	6.56e-09	66	162	423	529	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	6.58e-09	66	162	429	535	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	2.24e-13	62	162	1410	1515	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.24e-13	62	162	1410	1515	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	1.01e-10	28	166	12	157	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
B8F6F0	3.40e-07	67	142	193	279	Membrane-bound lytic murein transglycosylase C OS=Glaesserella parasuis serovar 5 (strain SH0165) OX=557723 GN=mltC PE=3 SV=1
A3N339	8.44e-07	67	142	194	280	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) OX=416269 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005234	0.092253	0.902269	0.000134	0.000115	0.000013

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000082_01800.