CAZyme Information: MGYG000000076_00820

Basic Information

• Species: Roseburia intestinalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia intestinalis
• CAZyme ID: MGYG000000076_00820
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
949	MGYG000000076_5|CGC3	109087.85	4.9101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000076	4318260	Isolate	United Kingdom	Europe

• Gene Location: Start: 106410; End: 109259 Strand: -

Full Sequence      

MEFCLVNGEAATFLLEEECYSGVAKIAEKVCGDVELVTGIRPVTRRISKTYLDEQKESEY
VVLVGTVGKSSVLEKLNGRVPLDKIRGKRESFLFQIVDNGTKATLVIAGSDKRGTIYGLF
HLSEYMGVSPWVHFSDVLPEKRKKLTLTEKDNMISREPSVKYRGFFINDEWPAFGSWTFE
HFGGFTEEMYDLIFETLLRLKGNYLWPAMWTSSFSLDGPGDANARLADEYGIVMSNSHHE
PCLRHSEEWDLVRGEDSVYGNEWNYVTNREGLLRYWRDGLQRNGKFENIITIGMRGERDS
MMLGSDATLKQNIDLLKDIITEQRKLIAECINSDAPQMIALYKEVEAYFYGNEGMMDGLK
DWDGLDGVTFMLCEDNFGNMRTLPTAELKNRKGGWGMYYHFDYHGGPISYEWVNSSYLPK
IWDQMTEAYEFGIRDIWVVNVGDLKFQEYPLSFFMDLAYDYDKWGISNYNAPEEYLKYWI
DREFGSRLEHQAKQKLETIMKGYTRLSHNRKAEAMAPETYHPVHYCEAERMLKQVKELER
CLAALEVQIPNELFPAFFELVYYPAKGSLNVQKLNLLAGMNHYYAKQGAVIANDYANELK
KCIEADNRLTKQLNALLGGKWNGMGASEHIGFRNWNEEECQYPVRMYVEPANKARILSYV
KGDGEVVTAGGDWTGKKLVLKQFLRPDTDNGTVVILNGGREPVEYEIQCDNPGIFFDKKS
GRLETRDEITVSIDKNSMGENKTFVIHYRGGNIHCEIPVRQQLPEKLKEMTFVETDGIIA
IEAEHYAEAESGDGGKFEKIPEYGKTLSGMKAYPCDRTFAENEGPKLIYRIYVEEEGNYR
ILLYTAPANPLNQWDRVEFGLSVNGRETRQIPLIPEHYISGEPSCQEWCEMVLNQIRIVE
CKDYLRQGENEIQIQAVKPGFLLEKLVIVKAEKKLPESYLGPEESYYIY

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	3	652	3.3e-210	0.8536585365853658

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	5.01e-175	157	513	2	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	4.25e-46	771	944	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.76e-05	35	122	39	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
COG3661	AguA2	6.57e-04	61	171	71	175	Alpha-glucuronidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV24041.1	0.0	1	949	1	949
VCV21315.1	0.0	1	945	1	947
EEU99942.1	0.0	1	945	1	947
CBL13087.1	0.0	1	944	1	946
QAY66984.1	9.21e-315	9	948	12	965

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NPS_A	1.65e-313	11	948	20	966	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4ZMH_A	3.93e-159	11	945	23	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	1.83e-116	5	836	20	723	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	5.00e-115	5	836	19	722	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	2.06e-111	5	945	47	849	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000076_00820.