CAZyme Information: MGYG000000075_01822

Basic Information

• Species: Paraclostridium tenue
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium tenue
• CAZyme ID: MGYG000000075_01822
• CAZy Family: GH73
• CAZyme Description: Beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228		25328.41	9.6166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000075	3140683	Isolate	United Kingdom	Europe

• Gene Location: Start: 1826937; End: 1827623 Strand: -

Full Sequence      

MIASSSGGFINASRSDIEHYLNPNNFKNGKKGMLQFLRLDSYKGGITAGELNGYLNSLKP
ASSGTNVFYNQGQAFINAARKYNIDLSYLVGHSMLETGYGRSTLAQGQVLTSYKGKPLPQ
PVKVYNFFGIGAFDGTANLSGAEAAYKNGWTSVEKTIEGSARWISSNYIHHGSYGQNTLY
KMRWSYDHLHHQYATDVNWANAISGIMYKFIGMYDTNSNLIFEIPVHR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	72	209	8.1e-27	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	1.28e-59	3	228	42	245	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
smart00047	LYZ2	1.56e-22	70	210	11	139	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.90e-09	72	159	1	76	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	3.93e-06	61	201	32	173	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	1.34e-05	79	218	335	470	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEZ68409.1	1.91e-136	6	228	172	394
QYE98702.1	5.45e-132	5	228	588	811
CEJ72783.1	2.15e-131	5	228	672	895
CEK37256.1	9.32e-131	5	228	676	899
AUN13473.1	5.69e-130	5	228	756	979

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WQW_A	1.30e-41	11	226	41	268	X-raystructure of catalytic domain of autolysin from Clostridium perfringens [Clostridium perfringens str. 13]
6FXO_A	1.98e-33	7	228	35	244	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus Mu50]
4PI7_A	1.44e-28	64	209	76	210	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PI9_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PIA_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
4PI8_A	1.11e-27	64	209	76	210	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
6FXP_A	4.27e-25	12	210	49	229	ChainA, Uncharacterized protein [Staphylococcus aureus subsp. aureus Mu50],6FXP_B Chain B, Uncharacterized protein [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39848	3.13e-42	8	228	678	880	Beta-N-acetylglucosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lytD PE=1 SV=1
Q8CPQ1	6.10e-35	11	228	1130	1335	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=atl PE=3 SV=1
O33635	1.54e-34	11	228	1130	1335	Bifunctional autolysin OS=Staphylococcus epidermidis OX=1282 GN=atl PE=1 SV=1
Q5HQB9	1.54e-34	11	228	1130	1335	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=atl PE=3 SV=1
Q6GI31	2.11e-30	7	228	1048	1257	Bifunctional autolysin OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=atl PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999823	0.000222	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000075_01822.