CAZyme Information: MGYG000000060_01098

Basic Information

• Species: Lachnospira eligens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira eligens_A
• CAZyme ID: MGYG000000060_01098
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	MGYG000000060_3|CGC1	46172.9	4.8583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000060	3236509	Isolate	United Kingdom	Europe

• Gene Location: Start: 120740; End: 121975 Strand: -

Full Sequence      

MDTIHSDIFPDGTPVDGWFHNTSIPELTKLGKQYIITDYGIHDDGRIYTDNFQKLIDLVY
NAGGGVIVIPHGTYMTGALFFRQGVNLYIEDDATLMGSDDISDYPVCETRIEGETCQYFT
ALINASGIDGFTLCGNGTIDGNGLRSWKAFWQRRTWNPDCTNKDEQRARLIYMSGCTNVT
VAGLHICNSQFWTNHLYRCSHVRYLNCRITSPSAPVKAPSTDAIDIDACTDILIKGCTIN
VNDDAVALKGGKGPFADNDPDNGANERIIIEDCTFEFCHGCLTCGSESIHNKNIIMRHIK
VDSGYNLLWLKMRPDTPQHYEYITIEYVQGKIFNFININPWTQFFDLKGRTDIPPSSTEH
IIIRKNTCTCNVFRNIKEAPEQYTLADIQIDDNIIEEIGTPSDKSKHTGAE

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	62	391	1.3e-51	0.9015384615384615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	3.91e-39	36	411	85	483	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	3.74e-14	117	295	42	197	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02188	PLN02188	5.41e-11	39	275	42	276	polygalacturonase/glycoside hydrolase family protein
PLN03003	PLN03003	9.46e-10	18	251	6	218	Probable polygalacturonase At3g15720
PLN03010	PLN03010	1.10e-09	31	251	44	237	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72869.1	4.59e-312	1	411	1	411
AVM67897.1	1.63e-200	7	391	10	394
QNM03706.1	8.33e-194	5	392	8	394
QJR62619.1	4.80e-166	1	385	14	398
ALK82912.1	4.80e-166	1	385	14	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	4.93e-29	32	287	43	312	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	3.10e-08	16	143	136	273	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	3.70e-18	36	251	65	279	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
A1DBT5	4.23e-11	77	251	64	236	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xghA PE=3 SV=1
Q9LW07	1.16e-10	18	270	6	237	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1
P15922	2.47e-09	8	288	128	437	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P43212	6.90e-09	128	304	145	302	Polygalacturonase OS=Cryptomeria japonica OX=3369 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000032	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000060_01098.