CAZyme Information: MGYG000000055_01724

Basic Information

• Species: Muribaculum intestinale
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum intestinale
• CAZyme ID: MGYG000000055_01724
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		51844.3	6.3544

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000055	3235245	Isolate	United Kingdom	Europe

• Gene Location: Start: 15193; End: 16557 Strand: +

Full Sequence      

MKLRRYLIAMTAVASLSGMAASGSTERTSDTKWTRFSHTQADGWYTTDDARGVADNVLLY
QKNSGGWPKNIPMHMAMSDADRERVAGEKDSKEASKKGCMDNDATTSEIRFLARMWRANG
DSIYLDGARRGVRFILDSQYPNAEAPDTRAGGWPQYYPLRGGYSDYFTFNDNLHINNMVL
LRDLLDPSTEVGSILPVEWRADVEQAYRAGLQCILDCQVVEDGVKTMWCAQHDPYTLLPA
EGRPHELPAYSADEGTSILWFLMSLDEPTAEIVDAVEHAVAFLEKTAIEGKKPEFVYNDR
GSRIDEVVVDCDSSRMWGRFIQLGGDVAARVYPDFFERLKERRPRTLSVGGDTLRYELWR
NAAESYDAARAHRPIYSIYDDTRPHHLFRFLYSFSDLEPVADSQCGYMFAPSLNAARRIR
YRYLGTWPDFILKGQYPEWHARMERKFGKKRGKN

Enzyme Prediction     

No EC number prediction in MGYG000000055_01724.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	61	325	2.3e-85	0.8680555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	1.58e-84	61	324	1	250	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	3.10e-79	61	343	1	276	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR09858.1	0.0	1	454	1	454
ANU62800.2	0.0	1	454	1	454
ASB36702.1	0.0	1	454	1	454
QDO69049.1	8.54e-66	33	323	34	312
ALJ61046.1	9.55e-65	33	323	34	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.07e-43	44	326	77	361	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	4.04e-37	54	323	37	283	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	5.52e-36	54	323	37	283	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004367	0.566851	0.423692	0.004074	0.000759	0.000229

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000055_01724.