CAZyme Information: MGYG000000055_01162

Basic Information

• Species: Muribaculum intestinale
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Muribaculum; Muribaculum intestinale
• CAZyme ID: MGYG000000055_01162
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000000055_9|CGC1	44617.41	6.4952

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000055	3235245	Isolate	United Kingdom	Europe

• Gene Location: Start: 29190; End: 30410 Strand: -

Full Sequence      

MYYLCGNYENYTNCNTLNDMIKSSMKYAIRVSAFSMLMFGSMGISAQQVHTAEWADGVER
ALVYRPGDYGSKFYRIPAIVTAKDGSLVTVADKRIEHNGDLPAKIDVVSRRSTDGGRTWS
EYVTVAAHDEIGGCGDPALVVDQKSGDILAIFSHGNGLWQESPAHISVARSKDNGLTWGP
ILDINPQILTTDPSGKQPIKCTSAFASSGRATQLDNGRIMFPLVVREKENPCFKVYAIYS
DDCGKTWMVSKNPATADGDESKIVQLADGSLIMSIRNRFGSLRKFSYSHDRGETWSDPVP
MEGLPDPRCNGDIIRYNRDGHDLLLQSLPGDPNGRNNVAIYVSKDGGKTWPVKKTVVTIP
SAYSSMTILPDGSIGILTEESANGHYSYDIWYTRMPIEVILAGDKK

Enzyme Prediction     

No EC number prediction in MGYG000000055_01162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	65	395	8.6e-86	0.9619883040935673

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.17e-109	62	396	2	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	4.74e-34	106	376	17	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	5.26e-16	70	377	271	638	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam13859	BNR_3	5.37e-16	84	335	8	254	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam15902	Sortilin-Vps10	1.65e-04	240	350	6	109	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU63021.2	1.41e-308	1	406	1	406
ASB38906.1	1.41e-308	1	406	1	406
QQR09640.1	1.15e-291	20	406	1	387
BBL05903.1	2.14e-94	63	403	32	380
BBD46557.1	3.29e-93	60	401	145	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MNJ_A	9.48e-40	63	381	189	523	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
1EUR_A	1.68e-39	67	387	18	352	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
4FJ6_A	8.95e-39	63	381	170	506	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
1EUT_A	5.56e-38	67	387	18	352	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
6MYV_A	6.36e-38	63	381	170	506	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	4.21e-37	67	387	60	394	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P31206	5.91e-37	56	381	182	528	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P10481	5.21e-29	69	388	31	369	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
P29767	4.70e-25	53	402	374	828	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P29768	5.47e-16	71	311	33	279	Sialidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=nanH PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.671903	0.315396	0.011417	0.000437	0.000299	0.000553

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000055_01162.